BLASTX nr result
ID: Rehmannia25_contig00007086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00007086 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431320.1| hypothetical protein CICLE_v10013129mg [Citr... 55 1e-05 >ref|XP_006431320.1| hypothetical protein CICLE_v10013129mg [Citrus clementina] gi|557533377|gb|ESR44560.1| hypothetical protein CICLE_v10013129mg [Citrus clementina] Length = 120 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +2 Query: 32 EEFPMESEANRRILQAGRGGKTITYP-VQNPTRTHCDRNVYGSCIGKDSKFYTARPCNYA 208 EEF MESE + R+L A GG I+Y ++ P CD +YG+CI K + RPC Y Sbjct: 57 EEFLMESEVSHRLLAAS-GGNPISYASLEKPA--FCDAKIYGNCI-KPTSGNNRRPCTYY 112 Query: 209 NTCNRPGS 232 NTC R GS Sbjct: 113 NTCKRGGS 120