BLASTX nr result
ID: Rehmannia25_contig00005073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00005073 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEP68101.1| raffinose synthase [Boea hygrometrica] 59 7e-07 gb|EXB93571.1| hypothetical protein L484_014563 [Morus notabilis] 57 3e-06 ref|XP_002275628.1| PREDICTED: galactinol--sucrose galactosyltra... 56 6e-06 emb|CAN60422.1| hypothetical protein VITISV_021070 [Vitis vinifera] 56 6e-06 ref|XP_006840967.1| hypothetical protein AMTR_s00085p00038660 [A... 55 1e-05 >gb|AEP68101.1| raffinose synthase [Boea hygrometrica] Length = 793 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 394 PVACRVNGERVRFVYEDNMVIIQVPWPNSSSGISVIDYLF 275 PVACR+NGE V F YE+ MV++Q+PWPN S G SVI+YLF Sbjct: 755 PVACRLNGEIVAFGYEEYMVMVQIPWPN-SPGTSVIEYLF 793 >gb|EXB93571.1| hypothetical protein L484_014563 [Morus notabilis] Length = 784 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 394 PVACRVNGERVRFVYEDNMVIIQVPWPNSSSGISVIDYLF 275 PVAC V+G V+F YED MV +QVPWPNSSS S+++YLF Sbjct: 746 PVACMVDGVSVKFGYEDKMVSVQVPWPNSSSE-SIVEYLF 784 >ref|XP_002275628.1| PREDICTED: galactinol--sucrose galactosyltransferase [Vitis vinifera] gi|296087624|emb|CBI34880.3| unnamed protein product [Vitis vinifera] Length = 775 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 394 PVACRVNGERVRFVYEDNMVIIQVPWPNSSSGISVIDYLF 275 P +CR+NGE V F Y++ MVIIQVPWPNSS+ S+I+YLF Sbjct: 737 PRSCRINGEEVAFGYDECMVIIQVPWPNSSNP-SLIEYLF 775 >emb|CAN60422.1| hypothetical protein VITISV_021070 [Vitis vinifera] Length = 762 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 394 PVACRVNGERVRFVYEDNMVIIQVPWPNSSSGISVIDYLF 275 P +CR+NGE V F Y++ MVIIQVPWPNSS+ S+I+YLF Sbjct: 724 PRSCRINGEEVAFGYDECMVIIQVPWPNSSNP-SLIEYLF 762 >ref|XP_006840967.1| hypothetical protein AMTR_s00085p00038660 [Amborella trichopoda] gi|548842859|gb|ERN02642.1| hypothetical protein AMTR_s00085p00038660 [Amborella trichopoda] Length = 787 Score = 55.1 bits (131), Expect = 1e-05 Identities = 20/40 (50%), Positives = 31/40 (77%) Frame = -1 Query: 394 PVACRVNGERVRFVYEDNMVIIQVPWPNSSSGISVIDYLF 275 P AC +NG+ V F+YE+ M+++QVPWP + GIS ++Y+F Sbjct: 748 PEACLLNGKEVGFLYEEEMIVVQVPWPEALGGISELEYIF 787