BLASTX nr result
ID: Rehmannia25_contig00004529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00004529 (651 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433428.1| hypothetical protein CICLE_v10002947mg [Citr... 56 8e-06 >ref|XP_006433428.1| hypothetical protein CICLE_v10002947mg [Citrus clementina] gi|568836135|ref|XP_006472103.1| PREDICTED: uncharacterized protein LOC102616658 [Citrus sinensis] gi|557535550|gb|ESR46668.1| hypothetical protein CICLE_v10002947mg [Citrus clementina] Length = 98 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 650 ALAGAAVVEYYDHKSGGKSTDRYSKFLPVDTYS 552 ALAGAAVVEYYDHKSG K TDRY+KFLP D Y+ Sbjct: 64 ALAGAAVVEYYDHKSGSK-TDRYAKFLPADPYA 95