BLASTX nr result
ID: Rehmannia25_contig00004370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00004370 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277957.1| PREDICTED: carbonic anhydrase, chloroplastic... 114 2e-23 emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera] 114 2e-23 ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic... 113 2e-23 ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic... 113 2e-23 ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum] gi... 113 2e-23 gb|AEV42276.1| chloroplast beta carbonic anhydrase 1 [Mesembryan... 112 4e-23 dbj|BAA95793.1| carbonic anhydrase [Nicotiana tabacum] 111 9e-23 sp|P27141.1|CAHC_TOBAC RecName: Full=Carbonic anhydrase, chlorop... 111 9e-23 dbj|BAA25639.1| NPCA1 [Nicotiana paniculata] 111 9e-23 gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] 111 9e-23 gb|AAY17070.1| chloroplast carbonic anhydrase [Nicotiana bentham... 111 9e-23 emb|CBL86547.1| carbonic anhydrase [Olea europaea] 111 9e-23 gb|ABI14813.1| chloroplast carbonic anhydrase [Pachysandra termi... 110 1e-22 gb|AAA34026.1| carbonic anhydrase precursor [Spinacia oleracea] 110 2e-22 prf||1707317A carbonic anhydrase 110 2e-22 gb|AGS78351.1| chloroplast beta-carbonic anhydrase [Leucaena leu... 109 3e-22 ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula] gi|... 109 4e-22 ref|XP_003618283.1| Carbonic anhydrase [Medicago truncatula] gi|... 109 4e-22 ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula] gi|... 109 4e-22 ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula] gi|... 109 4e-22 >ref|XP_002277957.1| PREDICTED: carbonic anhydrase, chloroplastic [Vitis vinifera] gi|296087661|emb|CBI34917.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 114 bits (284), Expect = 2e-23 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -1 Query: 472 AQCEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 A CEKEAVNVSLGNLLSYPFVREGLVKKTL LKGGYYDFVKG+FELWGL+FGLSPS SV Sbjct: 266 AYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLKGGYYDFVKGTFELWGLDFGLSPSFSV 324 >emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera] Length = 331 Score = 114 bits (284), Expect = 2e-23 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -1 Query: 472 AQCEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 A CEKEAVNVSLGNLLSYPFVREGLVKKTL LKGGYYDFVKG+FELWGL+FGLSPS SV Sbjct: 273 AYCEKEAVNVSLGNLLSYPFVREGLVKKTLTLKGGYYDFVKGTFELWGLDFGLSPSFSV 331 >ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 333 Score = 113 bits (283), Expect = 2e-23 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGGYYDFVKG FELWGLEFGLSP LSV Sbjct: 265 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 [Solanum tuberosum] gi|387157286|dbj|BAM15483.1| carbonic anhydrase, partial [Solanum tuberosum] Length = 321 Score = 113 bits (283), Expect = 2e-23 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGGYYDFVKG FELWGLEFGLSP LSV Sbjct: 265 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum] gi|56562177|emb|CAH60891.1| carbonic anhydrase [Solanum lycopersicum] Length = 321 Score = 113 bits (283), Expect = 2e-23 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGGYYDFVKG FELWGLEFGLSP LSV Sbjct: 265 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >gb|AEV42276.1| chloroplast beta carbonic anhydrase 1 [Mesembryanthemum nodiflorum] Length = 325 Score = 112 bits (281), Expect = 4e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVR+GLVKKTLALKGGYYDFV G+FELWGLEFGLSPSLSV Sbjct: 269 CEKEAVNVSLGNLLTYPFVRDGLVKKTLALKGGYYDFVNGTFELWGLEFGLSPSLSV 325 >dbj|BAA95793.1| carbonic anhydrase [Nicotiana tabacum] Length = 130 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGG+YDFV G FELWGLEFGLSPSLSV Sbjct: 74 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 130 >sp|P27141.1|CAHC_TOBAC RecName: Full=Carbonic anhydrase, chloroplastic; AltName: Full=Carbonate dehydratase; Flags: Precursor gi|170219|gb|AAA34065.1| chloroplast carbonic anhydrase [Nicotiana tabacum] gi|445610|prf||1909357A carbonic anhydrase Length = 321 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGG+YDFV G FELWGLEFGLSPSLSV Sbjct: 265 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 321 >dbj|BAA25639.1| NPCA1 [Nicotiana paniculata] Length = 322 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGG+YDFV G FELWGLEFGLSPSLSV Sbjct: 266 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 322 >gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] Length = 264 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGG+YDFV G FELWGLEFGLSPSLSV Sbjct: 208 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 264 >gb|AAY17070.1| chloroplast carbonic anhydrase [Nicotiana benthamiana] Length = 177 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLVKKTLALKGG+YDFV G FELWGLEFGLSPSLSV Sbjct: 121 CEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 177 >emb|CBL86547.1| carbonic anhydrase [Olea europaea] Length = 87 Score = 111 bits (278), Expect = 9e-23 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELW LEFGLS S+SV Sbjct: 31 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWSLEFGLSKSVSV 87 >gb|ABI14813.1| chloroplast carbonic anhydrase [Pachysandra terminalis] Length = 324 Score = 110 bits (276), Expect = 1e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKE+VNVSLGNLL+YPFVREGLVKKTLALKGGYYDFV GSFELWGL+FGL PSLSV Sbjct: 268 CEKESVNVSLGNLLTYPFVREGLVKKTLALKGGYYDFVNGSFELWGLDFGLXPSLSV 324 >gb|AAA34026.1| carbonic anhydrase precursor [Spinacia oleracea] Length = 254 Score = 110 bits (274), Expect = 2e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVR+GLVKKTLAL+GGYYDFV GSFELWGLEFGLSPS SV Sbjct: 198 CEKEAVNVSLGNLLTYPFVRDGLVKKTLALQGGYYDFVNGSFELWGLEFGLSPSQSV 254 >prf||1707317A carbonic anhydrase Length = 254 Score = 110 bits (274), Expect = 2e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVR+GLVKKTLAL+GGYYDFV GSFELWGLEFGLSPS SV Sbjct: 198 CEKEAVNVSLGNLLTYPFVRDGLVKKTLALQGGYYDFVNGSFELWGLEFGLSPSQSV 254 >gb|AGS78351.1| chloroplast beta-carbonic anhydrase [Leucaena leucocephala] Length = 326 Score = 109 bits (273), Expect = 3e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLV KTL+LKGGYYDFVKGSFELWGL+FGLS SLSV Sbjct: 270 CEKEAVNVSLGNLLTYPFVREGLVNKTLSLKGGYYDFVKGSFELWGLQFGLSSSLSV 326 >ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula] gi|355493299|gb|AES74502.1| Carbonic anhydrase [Medicago truncatula] Length = 260 Score = 109 bits (272), Expect = 4e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLV KTLALKGGYYDFVKGSFELWGLEFGLS + SV Sbjct: 204 CEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTFSV 260 >ref|XP_003618283.1| Carbonic anhydrase [Medicago truncatula] gi|355493298|gb|AES74501.1| Carbonic anhydrase [Medicago truncatula] Length = 185 Score = 109 bits (272), Expect = 4e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLV KTLALKGGYYDFVKGSFELWGLEFGLS + SV Sbjct: 118 CEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTFSV 174 >ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula] gi|355493295|gb|AES74498.1| Carbonic anhydrase [Medicago truncatula] Length = 342 Score = 109 bits (272), Expect = 4e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLV KTLALKGGYYDFVKGSFELWGLEFGLS + SV Sbjct: 275 CEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTFSV 331 >ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula] gi|355493296|gb|AES74499.1| Carbonic anhydrase [Medicago truncatula] Length = 331 Score = 109 bits (272), Expect = 4e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 466 CEKEAVNVSLGNLLSYPFVREGLVKKTLALKGGYYDFVKGSFELWGLEFGLSPSLSV 296 CEKEAVNVSLGNLL+YPFVREGLV KTLALKGGYYDFVKGSFELWGLEFGLS + SV Sbjct: 275 CEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLSSTFSV 331