BLASTX nr result
ID: Rehmannia25_contig00004077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00004077 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] 65 9e-09 gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] 65 9e-09 gb|EXA52568.1| 40S ribosomal protein S15 [Fusarium oxysporum f. ... 65 9e-09 gb|EWY93481.1| 40S ribosomal protein S15 [Fusarium oxysporum FOS... 65 9e-09 emb|CDM27705.1| 40S ribosomal protein S15 [Penicillium roqueforti] 65 9e-09 dbj|BAA01746.1| ribosomal protein S15 [Oryza sativa] 65 9e-09 ref|XP_001221950.1| 40S ribosomal protein S15 [Chaetomium globos... 65 9e-09 ref|XP_380571.1| RS15_PODAN 40S RIBOSOMAL PROTEIN S15 (S12) [Fus... 65 9e-09 ref|XP_006650736.1| PREDICTED: 40S ribosomal protein S15-like [O... 65 9e-09 gb|ETS87976.1| 40S ribosomal protein S15 [Pestalotiopsis fici W1... 65 9e-09 ref|XP_006352119.1| PREDICTED: 40S ribosomal protein S15-like [S... 65 9e-09 ref|XP_006350663.1| PREDICTED: 40S ribosomal protein S15-like [S... 65 9e-09 gb|ESW32413.1| hypothetical protein PHAVU_002G320200g [Phaseolus... 65 9e-09 gb|ESW26074.1| hypothetical protein PHAVU_003G089200g [Phaseolus... 65 9e-09 gb|ESW16696.1| hypothetical protein PHAVU_007G178000g [Phaseolus... 65 9e-09 ref|XP_006443898.1| hypothetical protein CICLE_v10022652mg [Citr... 65 9e-09 ref|XP_006443897.1| hypothetical protein CICLE_v10022652mg [Citr... 65 9e-09 ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citr... 65 9e-09 gb|ERZ98248.1| hypothetical protein GLOINDRAFT_287866 [Rhizophag... 65 9e-09 ref|XP_002312569.2| hypothetical protein POPTR_0008s16180g, part... 65 9e-09 >gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|EXA52568.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. pisi HDV247] Length = 237 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 208 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 237 >gb|EWY93481.1| 40S ribosomal protein S15 [Fusarium oxysporum FOSC 3-a] gi|587704605|gb|EWZ51210.1| 40S ribosomal protein S15 [Fusarium oxysporum Fo47] gi|587719977|gb|EWZ91314.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. lycopersici MN25] Length = 237 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 208 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 237 >emb|CDM27705.1| 40S ribosomal protein S15 [Penicillium roqueforti] Length = 153 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 124 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 153 >dbj|BAA01746.1| ribosomal protein S15 [Oryza sativa] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >ref|XP_001221950.1| 40S ribosomal protein S15 [Chaetomium globosum CBS 148.51] gi|88181768|gb|EAQ89236.1| 40S ribosomal protein S15 [Chaetomium globosum CBS 148.51] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >ref|XP_380571.1| RS15_PODAN 40S RIBOSOMAL PROTEIN S15 (S12) [Fusarium graminearum PH-1] gi|408400700|gb|EKJ79777.1| hypothetical protein FPSE_00057 [Fusarium pseudograminearum CS3096] gi|475663970|gb|EMT61765.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. cubense race 4] gi|477507860|gb|ENH61154.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. cubense race 1] gi|517311156|emb|CCT63432.1| probable ribosomal protein S12, cytosolic [Fusarium fujikuroi IMI 58289] gi|558855489|gb|ESU05572.1| 40S ribosomal protein S15 [Fusarium graminearum PH-1] gi|584127662|gb|EWG37081.1| 40S ribosomal protein S15 [Fusarium verticillioides 7600] gi|584127663|gb|EWG37082.1| 40S ribosomal protein S15 [Fusarium verticillioides 7600] gi|584127664|gb|EWG37083.1| 40S ribosomal protein S15 [Fusarium verticillioides 7600] gi|587671141|gb|EWY93482.1| 40S ribosomal protein S15 [Fusarium oxysporum FOSC 3-a] gi|587671142|gb|EWY93483.1| 40S ribosomal protein S15 [Fusarium oxysporum FOSC 3-a] gi|587704606|gb|EWZ51211.1| 40S ribosomal protein S15 [Fusarium oxysporum Fo47] gi|587704607|gb|EWZ51212.1| 40S ribosomal protein S15 [Fusarium oxysporum Fo47] gi|587719978|gb|EWZ91315.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587719979|gb|EWZ91316.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587754853|gb|EXA52569.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. pisi HDV247] gi|587754854|gb|EXA52570.1| 40S ribosomal protein S15 [Fusarium oxysporum f. sp. pisi HDV247] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >ref|XP_006650736.1| PREDICTED: 40S ribosomal protein S15-like [Oryza brachyantha] gi|573926409|ref|XP_006650737.1| PREDICTED: 40S ribosomal protein S15-like [Oryza brachyantha] Length = 154 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 125 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 154 >gb|ETS87976.1| 40S ribosomal protein S15 [Pestalotiopsis fici W106-1] Length = 154 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 125 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 154 >ref|XP_006352119.1| PREDICTED: 40S ribosomal protein S15-like [Solanum tuberosum] Length = 151 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >ref|XP_006350663.1| PREDICTED: 40S ribosomal protein S15-like [Solanum tuberosum] Length = 151 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >gb|ESW32413.1| hypothetical protein PHAVU_002G320200g [Phaseolus vulgaris] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|ESW26074.1| hypothetical protein PHAVU_003G089200g [Phaseolus vulgaris] Length = 152 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 123 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|ESW16696.1| hypothetical protein PHAVU_007G178000g [Phaseolus vulgaris] Length = 151 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 122 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >ref|XP_006443898.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] gi|568851807|ref|XP_006479578.1| PREDICTED: 40S ribosomal protein S15-like [Citrus sinensis] gi|557546160|gb|ESR57138.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] Length = 155 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 126 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 155 >ref|XP_006443897.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] gi|557546159|gb|ESR57137.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] Length = 118 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 89 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 118 >ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] gi|568872733|ref|XP_006489520.1| PREDICTED: 40S ribosomal protein S15-like [Citrus sinensis] gi|557521990|gb|ESR33357.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] Length = 155 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 126 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 155 >gb|ERZ98248.1| hypothetical protein GLOINDRAFT_287866 [Rhizophagus irregularis DAOM 181602] Length = 149 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 120 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 149 >ref|XP_002312569.2| hypothetical protein POPTR_0008s16180g, partial [Populus trichocarpa] gi|550333190|gb|EEE89936.2| hypothetical protein POPTR_0008s16180g, partial [Populus trichocarpa] Length = 81 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 90 LAEFSISYKPVKHGRPGIGATHSSRFIPLK Sbjct: 52 LAEFSISYKPVKHGRPGIGATHSSRFIPLK 81