BLASTX nr result
ID: Rehmannia25_contig00003844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00003844 (778 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338585.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 103 9e-20 ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arab... 102 1e-19 ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [... 101 3e-19 sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subun... 100 7e-19 ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase sub... 97 5e-18 ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citr... 97 5e-18 ref|XP_004232316.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 97 5e-18 ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putat... 94 7e-17 ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago tr... 93 1e-16 gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] 92 2e-16 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 91 3e-16 ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 91 4e-16 ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] g... 91 6e-16 ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [S... 91 6e-16 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 90 7e-16 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 90 7e-16 ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putativ... 90 7e-16 ref|XP_003579252.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 90 1e-15 ref|XP_006840451.1| hypothetical protein AMTR_s00045p00172340 [A... 90 1e-15 ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 90 1e-15 >ref|XP_006338585.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Solanum tuberosum] gi|565342915|ref|XP_006338586.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Solanum tuberosum] Length = 64 Score = 103 bits (256), Expect = 9e-20 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 243 YKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 YKGPS++KEIVIGI+LG+VAGGLWKMHHWNNQRRTKEFYDLLDK EISVV D+ Sbjct: 11 YKGPSVVKEIVIGIALGIVAGGLWKMHHWNNQRRTKEFYDLLDKNEISVVVNDE 64 >ref|XP_002868657.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] gi|297314493|gb|EFH44916.1| hypothetical protein ARALYDRAFT_493950 [Arabidopsis lyrata subsp. lyrata] Length = 65 Score = 102 bits (255), Expect = 1e-19 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +3 Query: 240 VYKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 VYKGPS++KEI+ GI+LGL GGLWKMHHWNNQRRTKEFYDLL+KGEISVV ED+ Sbjct: 11 VYKGPSVVKEIIYGITLGLAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >ref|NP_001119340.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] gi|48428152|sp|Q9FNE0.1|CX5C4_ARATH RecName: Full=Putative cytochrome c oxidase subunit 5C-4; AltName: Full=Cytochrome c oxidase polypeptide Vc-4 gi|10178149|dbj|BAB11594.1| cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|332007158|gb|AED94541.1| putative cytochrome c oxidase subunit 5C-4 [Arabidopsis thaliana] Length = 65 Score = 101 bits (251), Expect = 3e-19 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +3 Query: 240 VYKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 VYKGPS++KEI+ GI+LG GGLWKMHHWNNQRRTKEFYDLL+KGEISVV ED+ Sbjct: 11 VYKGPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISVVVEDE 65 >sp|P19173.3|COX5C_IPOBA RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|58368|emb|CAA37470.1| unnamed protein product [Ipomoea batatas] gi|688313|gb|AAB31231.1| cytochrome c oxidase subunit Vc [Ipomoea batatas] Length = 64 Score = 100 bits (248), Expect = 7e-19 Identities = 42/56 (75%), Positives = 53/56 (94%) Frame = +3 Query: 237 VVYKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 +VYKGPS++KE+VIG SLGLVAGG WKMHHWN+QRRTKEFYD+L+KG+ISVV +++ Sbjct: 9 LVYKGPSVVKELVIGFSLGLVAGGFWKMHHWNSQRRTKEFYDMLEKGQISVVADEE 64 >ref|XP_006470279.1| PREDICTED: putative cytochrome c oxidase subunit 5C-4-like [Citrus sinensis] Length = 64 Score = 97.4 bits (241), Expect = 5e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +3 Query: 243 YKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 Y+GPS++KEIV GIS+GL AGGLWKMH WNNQRRT+EFYDLL+KGEISVV ED+ Sbjct: 11 YQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEKGEISVVVEDE 64 >ref|XP_006446555.1| hypothetical protein CICLE_v10017383mg [Citrus clementina] gi|557549166|gb|ESR59795.1| hypothetical protein CICLE_v10017383mg [Citrus clementina] Length = 72 Score = 97.4 bits (241), Expect = 5e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +3 Query: 243 YKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 Y+GPS++KEIV GIS+GL AGGLWKMH WNNQRRT+EFYDLL+KGEISVV ED+ Sbjct: 19 YQGPSVVKEIVYGISIGLFAGGLWKMHQWNNQRRTREFYDLLEKGEISVVVEDE 72 >ref|XP_004232316.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Solanum lycopersicum] Length = 64 Score = 97.4 bits (241), Expect = 5e-18 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +3 Query: 243 YKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 YKGPS++KEI+IGI+LG+VAGGLWK HHWNNQRRTKEFYDLL+K EISVV D Sbjct: 11 YKGPSVVKEIMIGIALGMVAGGLWKKHHWNNQRRTKEFYDLLEKNEISVVVND 63 >ref|XP_002524666.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] gi|223536027|gb|EEF37685.1| Cytochrome c oxidase polypeptide Vc-2, putative [Ricinus communis] Length = 65 Score = 93.6 bits (231), Expect = 7e-17 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 243 YKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 Y GPSI+KEI+ GISLGL AG LWKMHHWNNQ+R KEFYDLL++GEISVV ED+ Sbjct: 12 YNGPSIIKEIIYGISLGLGAGLLWKMHHWNNQKRAKEFYDLLERGEISVVVEDE 65 >ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 92.8 bits (229), Expect = 1e-16 Identities = 39/53 (73%), Positives = 50/53 (94%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 KGPS++KEI+IGI+LGLVAGG+WKMHHWN QR+T+ FYDLL+KGEISVV +++ Sbjct: 12 KGPSVVKEIIIGITLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVVVDEE 64 >gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 77 Score = 92.4 bits (228), Expect = 2e-16 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IG++LGL+AGG+WKMHHWN QR+T+ FYD+LDKG+ISVV ED Sbjct: 12 KGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVED 63 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 91.3 bits (225), Expect = 3e-16 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI+IGI+LGL AGG+WKMHHWN QR+T+ FYDLL+KGEI+VV E+ Sbjct: 12 KGPSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEE 63 >ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Setaria italica] gi|194693600|gb|ACF80884.1| unknown [Zea mays] gi|194705548|gb|ACF86858.1| unknown [Zea mays] gi|195605218|gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195608682|gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195610044|gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195618014|gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195655785|gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|414868438|tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] gi|414878119|tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] Length = 63 Score = 90.9 bits (224), Expect = 4e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IG++LGL+AGG+WKMHHWN QR+T+ FYD+LDKG+ISVV E+ Sbjct: 12 KGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] gi|48428177|sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|4850330|dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group] gi|113649528|dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group] gi|125579724|gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group] Length = 63 Score = 90.5 bits (223), Expect = 6e-16 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IG++LGLVAGGLWKMHHWN QR+T+ FYD+L+KG+ISVV E+ Sbjct: 12 KGPSVVKEICIGLTLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVVVEE 63 >ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] gi|241944051|gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] Length = 63 Score = 90.5 bits (223), Expect = 6e-16 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IG++LGL+AGG+WKMHHWN QR+T+ FYD+LDKG+ISVV E+ Sbjct: 12 KGPSVVKEIFIGMTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 90.1 bits (222), Expect = 7e-16 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +3 Query: 240 VYKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 V KGPS++KE+VIG LGL AGGLWKMHHWN QR+T+ FYDLL+KGEISVV +++ Sbjct: 10 VLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDEE 64 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 90.1 bits (222), Expect = 7e-16 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI+IGI+LGL AG +WKMHHWN QR+T+ FYDLL+KGEISVV E+ Sbjct: 12 KGPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEE 63 >ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|255559374|ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223540092|gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223545762|gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] Length = 63 Score = 90.1 bits (222), Expect = 7e-16 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IGI+LGL AGGLWKMHHWN QR+ + FYDLL+KGEISVV E+ Sbjct: 12 KGPSVVKEICIGIALGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 63 >ref|XP_003579252.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357161935|ref|XP_003579253.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|2493852|sp|Q42841.3|COX5C_HORVU RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|1070356|emb|CAA92107.1| cytochrome c oxidase, Vc subunit [Hordeum vulgare subsp. vulgare] gi|473894931|gb|EMS48910.1| Cytochrome c oxidase subunit 5C [Triticum urartu] gi|475558729|gb|EMT13154.1| Cytochrome c oxidase subunit 5C [Aegilops tauschii] Length = 63 Score = 89.7 bits (221), Expect = 1e-15 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVRED 401 KGPS++KEI IG++LGLVAGG+WKMHHWN QR+T+ FYD+L+KG+ISVV E+ Sbjct: 12 KGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVVVEE 63 >ref|XP_006840451.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda] gi|548842169|gb|ERN02126.1| hypothetical protein AMTR_s00045p00172340 [Amborella trichopoda] Length = 99 Score = 89.7 bits (221), Expect = 1e-15 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 6/74 (8%) Frame = +3 Query: 189 ISDHDTPPLRPTETMV------VVYKGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTK 350 I+ TP + E M V Y GPSI+KEI G++LGL+AGG+WK HHWN QR+TK Sbjct: 22 ITSDKTPDAKKEEAMAAHRIAHVAYTGPSIIKEIFYGMTLGLLAGGVWKTHHWNEQRKTK 81 Query: 351 EFYDLLDKGEISVV 392 FYDLL+KGEISVV Sbjct: 82 AFYDLLEKGEISVV 95 >ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Cicer arietinum] Length = 64 Score = 89.7 bits (221), Expect = 1e-15 Identities = 36/53 (67%), Positives = 48/53 (90%) Frame = +3 Query: 246 KGPSILKEIVIGISLGLVAGGLWKMHHWNNQRRTKEFYDLLDKGEISVVREDD 404 KGPS++KEI+IGI+LG+ AG +WKMHHWN QR+T+ FYDLL+KGEISV+ E++ Sbjct: 12 KGPSVVKEIIIGITLGIAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVIAEEE 64