BLASTX nr result
ID: Rehmannia25_contig00003173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00003173 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGN30962.1| chromoplast-specific carotenoid-associated protei... 73 3e-11 gb|ACC59805.1| chromoplast specific carotenoid associated protei... 72 6e-11 ref|XP_002524410.1| Plastid-lipid-associated protein, chloroplas... 71 2e-10 emb|CAA75657.1| Plastid-lipid-Associated Protein [Nicotiana taba... 68 1e-09 ref|XP_003594154.1| Plastid-lipid-associated protein [Medicago t... 68 1e-09 ref|XP_003546169.1| PREDICTED: plastid-lipid-associated protein,... 68 1e-09 ref|XP_003534708.1| PREDICTED: plastid-lipid-associated protein,... 68 1e-09 gb|ACJ85346.1| unknown [Medicago truncatula] 68 1e-09 ref|XP_004486195.1| PREDICTED: plastid-lipid-associated protein,... 67 2e-09 gb|AFK48303.1| unknown [Medicago truncatula] 67 2e-09 gb|AAY24688.1| fibrillin-like protein [Oncidium hybrid cultivar] 67 2e-09 ref|NP_001234183.1| plastid lipid associated protein CHRC [Solan... 67 2e-09 gb|ESW19671.1| hypothetical protein PHAVU_006G145100g [Phaseolus... 67 2e-09 ref|XP_003594155.1| Plastid-lipid-associated protein [Medicago t... 67 3e-09 gb|ABA43902.1| fibrillin [Coffea canephora] 67 3e-09 ref|NP_001275061.1| light-induced protein, chloroplastic [Solanu... 66 4e-09 gb|ACJ84978.1| unknown [Medicago truncatula] 66 4e-09 ref|XP_002333019.1| predicted protein [Populus trichocarpa] 66 5e-09 gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis] 65 7e-09 sp|O99019.1|LIPC_SOLDE RecName: Full=Light-induced protein, chlo... 65 7e-09 >gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus tazetta var. chinensis] Length = 316 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPLFD 171 PLK+PI+ KA+SWLLTTY+D ELRI++ADGG +FVL+K GSPL D Sbjct: 271 PLKIPIANDKAQSWLLTTYLDGELRISRADGGSVFVLIKEGSPLLD 316 >gb|ACC59805.1| chromoplast specific carotenoid associated protein [Oncidium hybrid cultivar] Length = 319 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PIS + A+SWLLTTY+DDELRI++ADGG +FVL+K GSPL Sbjct: 274 PIKFPISNSNAQSWLLTTYLDDELRISRADGGSVFVLIKEGSPL 317 >ref|XP_002524410.1| Plastid-lipid-associated protein, chloroplast precursor, putative [Ricinus communis] gi|223536371|gb|EEF38021.1| Plastid-lipid-associated protein, chloroplast precursor, putative [Ricinus communis] Length = 321 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPLFDSL 165 PLK+PIS A+SWLLTTY+D++LRI++AD G IFVL+K GSPL SL Sbjct: 272 PLKIPISNNNAQSWLLTTYLDEDLRISRADAGSIFVLIKEGSPLLTSL 319 >emb|CAA75657.1| Plastid-lipid-Associated Protein [Nicotiana tabacum] Length = 270 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PIS + A+SWLLTTY+D ELRI++ DGG +FVL+K GSPL Sbjct: 224 PIKFPISNSNAQSWLLTTYLDHELRISRGDGGSVFVLIKEGSPL 267 >ref|XP_003594154.1| Plastid-lipid-associated protein [Medicago truncatula] gi|87240800|gb|ABD32658.1| PAP fibrillin [Medicago truncatula] gi|355483202|gb|AES64405.1| Plastid-lipid-associated protein [Medicago truncatula] Length = 316 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D+ELR+A+ DGG +FVL+K GS L Sbjct: 270 PLKIPISNSYAQSWLLTTYLDEELRVARGDGGSVFVLIKEGSSL 313 >ref|XP_003546169.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Glycine max] Length = 306 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D+ELRI++ DGG +FVL+K GS L Sbjct: 260 PLKIPISNSNAQSWLLTTYLDEELRISRGDGGSVFVLIKEGSSL 303 >ref|XP_003534708.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Glycine max] Length = 312 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D+ELRI++ DGG +FVL+K GS L Sbjct: 266 PLKIPISNSNAQSWLLTTYLDEELRISRGDGGSVFVLIKEGSSL 309 >gb|ACJ85346.1| unknown [Medicago truncatula] Length = 315 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D+ELR+A+ DGG +FVL+K GS L Sbjct: 269 PLKIPISNSYAQSWLLTTYLDEELRVARGDGGSVFVLIKEGSSL 312 >ref|XP_004486195.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Cicer arietinum] gi|502183900|ref|XP_004517240.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Cicer arietinum] Length = 320 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK PIS KA+SWLLTTY+D+ELRI++ DGG +FVL+K GS L Sbjct: 271 PLKFPISNNKAQSWLLTTYLDEELRISRGDGGGVFVLIKEGSSL 314 >gb|AFK48303.1| unknown [Medicago truncatula] Length = 316 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D+ELR+A+ DGG +FVL+K GS L Sbjct: 270 PLKIPISNSYAQSWLLTTYLDEELRVARGDGGGVFVLIKEGSSL 313 >gb|AAY24688.1| fibrillin-like protein [Oncidium hybrid cultivar] Length = 319 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PIS + A+SWLLTTY+DDELRI++ADGG +FVL+ SPL Sbjct: 274 PIKFPISNSNAQSWLLTTYLDDELRISRADGGSVFVLILESSPL 317 >ref|NP_001234183.1| plastid lipid associated protein CHRC [Solanum lycopersicum] gi|83743301|gb|ABC42191.1| plastid lipid associated protein CHRC [Solanum lycopersicum] Length = 326 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PIS A+SWLLTTY+DDELRI++ D G +FVL+K GSPL Sbjct: 280 PIKFPISNNNAQSWLLTTYLDDELRISRGDAGSVFVLIKEGSPL 323 >gb|ESW19671.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris] Length = 310 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS + A+SWLLTTY+D ELRI++ DGG +FVL+K GS L Sbjct: 264 PLKIPISNSNAQSWLLTTYLDQELRISRGDGGSVFVLIKEGSSL 307 >ref|XP_003594155.1| Plastid-lipid-associated protein [Medicago truncatula] gi|87240799|gb|ABD32657.1| PAP fibrillin [Medicago truncatula] gi|355483203|gb|AES64406.1| Plastid-lipid-associated protein [Medicago truncatula] Length = 317 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS A+SWLLTTY+D+ELRI++ DGG +FVL+K GS L Sbjct: 271 PLKIPISNDNAQSWLLTTYLDEELRISRGDGGSVFVLIKEGSSL 314 >gb|ABA43902.1| fibrillin [Coffea canephora] Length = 320 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK +S AESWLLTTY+DDELRI++ DGG IFVL+K G PL Sbjct: 274 PLKFSLSNRNAESWLLTTYLDDELRISRGDGGSIFVLIKEGCPL 317 >ref|NP_001275061.1| light-induced protein, chloroplastic [Solanum tuberosum] gi|22261807|sp|P80471.2|LIPC_SOLTU RecName: Full=Light-induced protein, chloroplastic; AltName: Full=Drought-induced stress protein CDSP-34; Flags: Precursor gi|2598049|emb|CAA75558.1| chloroplast drought-induced stress protein, 34 kD) [Solanum tuberosum] Length = 326 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PI+ A+SWLLTTY+DDELRI++ D G +FVL+K GSPL Sbjct: 280 PIKFPITNNNAQSWLLTTYLDDELRISRGDAGSVFVLIKEGSPL 323 >gb|ACJ84978.1| unknown [Medicago truncatula] Length = 316 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK PIS + A+SWLLTTY+D+ELR+A+ DGG +FVL+K GS L Sbjct: 270 PLKTPISNSYAQSWLLTTYLDEELRVARGDGGGVFVLIKEGSSL 313 >ref|XP_002333019.1| predicted protein [Populus trichocarpa] Length = 85 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK IS AESWLLTTY+DD+LRI++ D G IFVL+K GSPL Sbjct: 39 PLKFSISNRNAESWLLTTYLDDDLRISRGDAGSIFVLIKEGSPL 82 >gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis] Length = 324 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 PLK+PIS A+SWLLTTY+D ELRI++ DGG +FVL+K GS L Sbjct: 278 PLKIPISNNNAQSWLLTTYLDGELRISRGDGGSVFVLIKEGSSL 321 >sp|O99019.1|LIPC_SOLDE RecName: Full=Light-induced protein, chloroplastic; AltName: Full=C40.4; Flags: Precursor gi|4007750|emb|CAA10372.1| fibrillin [Solanum demissum] Length = 326 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 308 PLKLPISYAKAESWLLTTYVDDELRIAKADGGDIFVLVKSGSPL 177 P+K PI+ A+SWLLTTY+DDELRI + D G +FVL+K GSPL Sbjct: 280 PIKFPITNNNAQSWLLTTYLDDELRIPRGDAGSVFVLIKEGSPL 323