BLASTX nr result
ID: Rehmannia25_contig00003155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00003155 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACT33043.1| RAV transcription factor [Camellia sinensis] 60 4e-07 ref|XP_002524409.1| DNA-binding protein RAV1, putative [Ricinus ... 59 5e-07 >gb|ACT33043.1| RAV transcription factor [Camellia sinensis] Length = 362 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 301 QPGQMVRLFGVNIFEVP-RNGVDS-CGGKRLIEMEILGLHTSKKQRV 167 QP QMVRLFGVNIF+VP G+DS CGGKR+ EME+L L SKK RV Sbjct: 312 QPVQMVRLFGVNIFKVPISGGLDSNCGGKRMREMELLALECSKKVRV 358 >ref|XP_002524409.1| DNA-binding protein RAV1, putative [Ricinus communis] gi|223536370|gb|EEF38020.1| DNA-binding protein RAV1, putative [Ricinus communis] Length = 371 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -1 Query: 301 QPGQMVRLFGVNIFEVPRNG-VDSCGGKRLIEMEILGLHTSKKQRV 167 QP QMVRLFGVNIF+VP N ++ C GKR+ EME+L L KKQRV Sbjct: 322 QPVQMVRLFGVNIFKVPGNSHIEGCNGKRIREMELLSLDCIKKQRV 367