BLASTX nr result
ID: Rehmannia25_contig00002677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00002677 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN32766.1| phenylalanine ammonia-lyase [Scutellaria baicalen... 107 2e-21 gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica] 105 6e-21 gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica] 105 6e-21 gb|AAN32867.1|AF460204_1 phenylalanine ammonia-lyase 2 [Coffea c... 105 6e-21 gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea c... 105 6e-21 gb|ACT22906.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] 102 4e-20 gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot ... 102 4e-20 gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot ... 102 4e-20 sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase... 102 5e-20 gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandif... 102 5e-20 gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica] 102 5e-20 ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citr... 101 9e-20 dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus] 101 1e-19 gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] 101 1e-19 gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena le... 101 1e-19 gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] 101 1e-19 gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] 101 1e-19 gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] 101 1e-19 gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] 101 1e-19 gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nig... 101 1e-19 >gb|ADN32766.1| phenylalanine ammonia-lyase [Scutellaria baicalensis] Length = 707 Score = 107 bits (267), Expect = 2e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE GT FLTGEKDRSPGEEFDKVFTAICEGKLIDP L+CLKEWNG+P+PIC Sbjct: 655 VREEAGTGFLTGEKDRSPGEEFDKVFTAICEGKLIDPFLECLKEWNGAPIPIC 707 >gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica] Length = 717 Score = 105 bits (262), Expect = 6e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VR E+GTNFLTGEK RSPGEEFDKVFTAICEGKLIDPLLDCLKEWNG+P PIC Sbjct: 665 VRGELGTNFLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC 717 >gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica] Length = 717 Score = 105 bits (262), Expect = 6e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VR E+GTNFLTGEK RSPGEEFDKVFTAICEGKLIDPLLDCLKEWNG+P PIC Sbjct: 665 VRGELGTNFLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC 717 >gb|AAN32867.1|AF460204_1 phenylalanine ammonia-lyase 2 [Coffea canephora] Length = 619 Score = 105 bits (262), Expect = 6e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VR E+GTNFLTGEK RSPGEEFDKVFTAICEGKLIDPLLDCLKEWNG+P PIC Sbjct: 567 VRGELGTNFLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC 619 >gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora] gi|70608410|gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora] gi|347438642|gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora] Length = 717 Score = 105 bits (262), Expect = 6e-21 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VR E+GTNFLTGEK RSPGEEFDKVFTAICEGKLIDPLLDCLKEWNG+P PIC Sbjct: 665 VRGELGTNFLTGEKVRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPRPIC 717 >gb|ACT22906.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] Length = 582 Score = 102 bits (255), Expect = 4e-20 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE GT FLTGEK RSPGEEFDKVF A+CEGKLIDPL+DCL+EWNG+PLPIC Sbjct: 530 VREEAGTGFLTGEKARSPGEEFDKVFRAMCEGKLIDPLMDCLREWNGAPLPIC 582 >gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta] Length = 712 Score = 102 bits (255), Expect = 4e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT LTGEK RSPGEEFDKVFTA+C+GK+IDP+LDCLKEWNG+PLPIC Sbjct: 660 VREEIGTGLLTGEKIRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC 712 >gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta] Length = 315 Score = 102 bits (255), Expect = 4e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT LTGEK RSPGEEFDKVFTA+C+GK+IDP+LDCLKEWNG+PLPIC Sbjct: 263 VREEIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC 315 >sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase gi|1276903|gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon] Length = 722 Score = 102 bits (254), Expect = 5e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VRE++GT+ LTGEK RSPGEEFDKVFTA+CEGKLIDP+L+CLKEWNG+PLPIC Sbjct: 668 VREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPIC 720 >gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus] Length = 708 Score = 102 bits (254), Expect = 5e-20 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GTN+LTGEK RSPGEEFDKVFTA+CEGKLIDPLL CLK+W+G+PLPIC Sbjct: 656 VREELGTNYLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLGCLKQWDGAPLPIC 708 >gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica] Length = 706 Score = 102 bits (254), Expect = 5e-20 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT FLTGEK SPGEEFDKVFTAIC GK+IDPLLDCLKEWNG+PLPIC Sbjct: 654 VREELGTGFLTGEKIVSPGEEFDKVFTAICNGKMIDPLLDCLKEWNGAPLPIC 706 >ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina] gi|568864526|ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis] gi|557538642|gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina] Length = 722 Score = 101 bits (252), Expect = 9e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK RSPGEEFDKVF A+CEGKLIDP+L+CLKEWNG+PLPIC Sbjct: 668 VREEIGTSLLTGEKVRSPGEEFDKVFAAMCEGKLIDPMLECLKEWNGAPLPIC 720 >dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus] Length = 716 Score = 101 bits (251), Expect = 1e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VRE+VG FLTGEKDRSPGEEFDKVFTA+C K+IDPLL+CLKEWNG+PLPIC Sbjct: 664 VREDVGAEFLTGEKDRSPGEEFDKVFTAMCNEKIIDPLLECLKEWNGAPLPIC 716 >gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus] Length = 715 Score = 101 bits (251), Expect = 1e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT LTGEK +SPGEEFDKVFTAIC+GK+IDP+L+CLKEWNG+PLPIC Sbjct: 663 VREEIGTGLLTGEKVKSPGEEFDKVFTAICQGKIIDPMLECLKEWNGAPLPIC 715 >gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala] Length = 365 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT LTGEK RSPGEEFDKVFTA+CEGKLIDPLLDCLK WNG+PLP+C Sbjct: 313 VREELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC 365 >gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 86 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK +SPGEEFDKVFTAIC GKLIDPLL+CLKEWNG+PLPIC Sbjct: 34 VREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 86 >gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 84 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK +SPGEEFDKVFTAIC GKLIDPLL+CLKEWNG+PLPIC Sbjct: 32 VREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 84 >gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 117 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK +SPGEEFDKVFTAIC GKLIDPLL+CLKEWNG+PLPIC Sbjct: 65 VREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 117 >gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 91 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK +SPGEEFDKVFTAIC GKLIDPLL+CLKEWNG+PLPIC Sbjct: 39 VREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 91 >gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327733|gb|AFR41240.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327735|gb|AFR41241.1| phenylalanine ammonia-lyase, partial [Populus nigra] gi|403327737|gb|AFR41242.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 1 VREEVGTNFLTGEKDRSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGSPLPIC 159 VREE+GT+ LTGEK +SPGEEFDKVFTAIC GKLIDPLL+CLKEWNG+PLPIC Sbjct: 68 VREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 120