BLASTX nr result
ID: Rehmannia24_contig00030291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00030291 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY26773.1| Regulator of Vps4 activity in the MVB pathway pro... 59 5e-07 >gb|EOY26773.1| Regulator of Vps4 activity in the MVB pathway protein, putative [Theobroma cacao] Length = 511 Score = 59.3 bits (142), Expect = 5e-07 Identities = 42/128 (32%), Positives = 57/128 (44%), Gaps = 26/128 (20%) Frame = +3 Query: 42 KPLTYKSIPPPYTKSEVSQPKNGDE-----------------DDLVPKTKPIPKSVRRRN 170 KP Y+ +PPPY + + + K+ E DD V ++KP P+SVRRR Sbjct: 290 KPFYYRFMPPPYVRPSLGKEKSSTEEPTTPSDNTDNEKNRKWDDSVGESKPKPRSVRRRP 349 Query: 171 PKPLPVREISEVDEKE---------KINKEKAAQGQRILKFFXXXXXXXXXXXXKMMDKL 323 K P RE+ DE + +N+E+A +G L KMMD L Sbjct: 350 LKTPPGREVLSSDENDGAAKNFSSSAVNREEARKG---LASIQMEESDERDNEEKMMDGL 406 Query: 324 LRHYSRKK 347 L HYS KK Sbjct: 407 LMHYSTKK 414