BLASTX nr result
ID: Rehmannia24_contig00030281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00030281 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76848.1| hypothetical protein VITISV_007375 [Vitis vinifera] 57 3e-06 >emb|CAN76848.1| hypothetical protein VITISV_007375 [Vitis vinifera] Length = 532 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -2 Query: 223 DNN*YYDSRSTNHITARLENLSLKANY*GNDHLVVGNGSKLPIFHVG 83 D + Y +S +TNH+T LENLS+K+NY G D LVV N +KL I HVG Sbjct: 477 DQSWYANSGATNHVTVELENLSMKSNYHGKDKLVVDNSNKLSITHVG 523