BLASTX nr result
ID: Rehmannia24_contig00030016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00030016 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus pe... 56 4e-06 gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis] 55 9e-06 >gb|EMJ14118.1| hypothetical protein PRUPE_ppa022280mg [Prunus persica] Length = 229 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 450 LKTIKSLVELLTPQQGAEFLMAAAELHFGIRG*GITQNRR 331 L+T++ +VELLTPQQ EFL+AAAEL FG+RG G+ Q+R+ Sbjct: 186 LRTVRKVVELLTPQQAVEFLIAAAELQFGVRGWGMNQDRQ 225 >gb|EXB22356.1| hypothetical protein L484_004349 [Morus notabilis] Length = 232 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 450 LKTIKSLVELLTPQQGAEFLMAAAELHFGIRG*GITQNR 334 L+T +S+V+LLTPQQ AEFL+AAAEL FG+RG G+ +R Sbjct: 189 LRTFQSVVDLLTPQQAAEFLIAAAELQFGVRGWGVNHDR 227