BLASTX nr result
ID: Rehmannia24_contig00029588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00029588 (590 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62805.1| hypothetical protein M569_11983, partial [Genlise... 56 8e-06 >gb|EPS62805.1| hypothetical protein M569_11983, partial [Genlisea aurea] Length = 715 Score = 55.8 bits (133), Expect = 8e-06 Identities = 34/74 (45%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = -3 Query: 216 MENGVLEFXXXXXXXXXXXXIEPPND--DEQMHDGSPNDANSLGSGSGDSAFAYHTYIPE 43 MENGV+EF IE ND +E+ D S +DA S GSGSG++ F YIPE Sbjct: 1 MENGVIEFDIGVGGADDRIEIEACNDHEEEEERDASTSDAYSHGSGSGENNFDMRIYIPE 60 Query: 42 *YLDLYPYEGMEFE 1 ++L P GMEFE Sbjct: 61 GDIELEPNVGMEFE 74