BLASTX nr result
ID: Rehmannia24_contig00029557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00029557 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530637.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 gb|EOX90748.1| Uncharacterized protein isoform 1 [Theobroma cacao] 55 1e-05 >ref|XP_002530637.1| conserved hypothetical protein [Ricinus communis] gi|223529810|gb|EEF31745.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/39 (53%), Positives = 31/39 (79%) Frame = +2 Query: 26 DESNNKVSSKKDENKDVRVEVKDWWTKSIYAYLNEPVMK 142 D+ +N +K +ENK+VR+ +KDWWTKS YAYLN+P ++ Sbjct: 101 DKKSNATLNKDEENKEVRIGIKDWWTKSKYAYLNQPALE 139 >gb|EOX90748.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 172 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 8/67 (11%) Frame = +2 Query: 2 KFVYSLEDDESNNKV--------SSKKDENKDVRVEVKDWWTKSIYAYLNEPVMKFEGNN 157 +F SL D+++N K S ++N ++RV +KDWWTKS YAYLN+P ++ +N Sbjct: 86 RFEESLNDEDNNPKEKITAPTNNSEGDEKNNEIRVGIKDWWTKSKYAYLNQPAVE-SMDN 144 Query: 158 PRGRPST 178 P+ R ST Sbjct: 145 PKRRAST 151