BLASTX nr result
ID: Rehmannia24_contig00029137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00029137 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330315.1| predicted protein [Populus trichocarpa] 56 4e-06 ref|XP_006475543.1| PREDICTED: uncharacterized protein LOC102610... 55 7e-06 >ref|XP_002330315.1| predicted protein [Populus trichocarpa] Length = 528 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/67 (35%), Positives = 40/67 (59%) Frame = -2 Query: 260 SIRSPKFDFPKFNGEEPRGWLRKCQKYFMINPMADYDKIVCAAMHMEGMAND*YLDYIEE 81 +I P+ + P F GE PRGWLRKC+KYF +N + + + + +++G A+ + I E Sbjct: 123 NIPLPRVELPTFRGENPRGWLRKCRKYFKMNTIPAHQWVEVVSYYLKGKADIWFEGLIRE 182 Query: 80 KKVWVCL 60 + W+ L Sbjct: 183 NESWMDL 189 >ref|XP_006475543.1| PREDICTED: uncharacterized protein LOC102610887 [Citrus sinensis] Length = 1274 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 2/81 (2%) Frame = -2 Query: 326 TRGDDGV-LPL-PNQGKQHENHLNSIRSPKFDFPKFNGEEPRGWLRKCQKYFMINPMADY 153 TR + G +P+ P G + + +R K +FP F GE P GW+ KC+++F N + + Sbjct: 57 TRSEGGSSIPIKPRTGSNPGMYNSQMRFSKLNFPTFEGENPSGWVYKCERFFKYNGVEES 116 Query: 152 DKIVCAAMHMEGMAND*YLDY 90 D + A +H+EG A + + Y Sbjct: 117 DMVGLATIHLEGKALEWFQGY 137