BLASTX nr result
ID: Rehmannia24_contig00029050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00029050 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein... 74 3e-11 ref|XP_004236403.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 gb|ESW30266.1| hypothetical protein PHAVU_002G138600g [Phaseolus... 67 2e-09 ref|XP_006343097.1| PREDICTED: protein Rf1, mitochondrial-like [... 67 2e-09 ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006368375.1| hypothetical protein POPTR_0001s02170g [Popu... 63 5e-08 ref|XP_002326536.1| predicted protein [Populus trichocarpa] 63 5e-08 ref|XP_004512504.1| PREDICTED: putative pentatricopeptide repeat... 60 2e-07 ref|XP_002527661.1| pentatricopeptide repeat-containing protein,... 56 6e-06 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Vitis vinifera] gi|297742067|emb|CBI33854.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/76 (48%), Positives = 52/76 (68%) Frame = +1 Query: 172 LRENNRELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACA 351 ++ +R + L VV+V KSLNWE++R + F+ T+ KYGF +S+ AF+ V V A A Sbjct: 78 MKRRSRIHRKHVLSPVVVKVFKSLNWEVARHIKFSTTMKKYGFSRSIDAFRTVVNVLALA 137 Query: 352 EMQLEVYALLREIVCY 399 M +EVYALLR+IVCY Sbjct: 138 GMHMEVYALLRDIVCY 153 >gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +1 Query: 220 VVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCY 399 VVRV KSLNW+I+R++ F YGFD S+ AF++ + ++A A MQ+E +ALLR+IVCY Sbjct: 81 VVRVFKSLNWDIAREIRFNMAAKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLRDIVCY 140 >ref|XP_004236403.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Solanum lycopersicum] Length = 784 Score = 67.8 bits (164), Expect = 1e-09 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 2/117 (1%) Frame = +1 Query: 55 KDCSFLCNKYRR--VSAVPLLDDSDYYXXXXXXXXXXXXXFLRENNRELKSVELFSAVVR 228 K+ LC KY S++PLL DSD N+ K +++S VVR Sbjct: 25 KEQRSLCRKYYHGASSSLPLLYDSD------------KAVIPTRNSLNWKGRKVYSVVVR 72 Query: 229 VLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCY 399 V KSL+W++ R++ F ++ KYG S+ ++M + +A A M +EV+ LL+E++ Y Sbjct: 73 VCKSLSWKVVREISFVESLAKYGLYHSINGYRMIIHTFAFAGMDMEVHTLLKEMIFY 129 >gb|ESW30266.1| hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] Length = 831 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/66 (46%), Positives = 46/66 (69%) Frame = +1 Query: 205 ELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 384 E F V RVLKSL+W ++R+V F V+ +GF S+ F++ V +A A M+LEV+ALLR Sbjct: 63 EYFPLVSRVLKSLSWRVAREVRFGSWVESHGFSHSINCFRIIVHAFALAGMRLEVFALLR 122 Query: 385 EIVCYC 402 ++V +C Sbjct: 123 DVVGFC 128 >ref|XP_006343097.1| PREDICTED: protein Rf1, mitochondrial-like [Solanum tuberosum] Length = 756 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 2/117 (1%) Frame = +1 Query: 55 KDCSFLCNKYRR--VSAVPLLDDSDYYXXXXXXXXXXXXXFLRENNRELKSVELFSAVVR 228 K+ LC KY S++PLL DSD N+ K +++S VV Sbjct: 25 KEQRSLCRKYYHGASSSLPLLYDSD------------KAVIPTRNSLNWKGRKVYSVVVT 72 Query: 229 VLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCY 399 V KSL+WE+++++ F +++ YG S+ ++M + +A A M LEVY LL++++ Y Sbjct: 73 VCKSLSWEVAKEIPFEKSLKNYGLYHSISGYRMMIHTFAFAGMDLEVYTLLKQMIFY 129 >ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X1 [Glycine max] gi|571433663|ref|XP_006572969.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X2 [Glycine max] gi|571433665|ref|XP_006572970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X3 [Glycine max] gi|571433667|ref|XP_006572971.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X4 [Glycine max] Length = 734 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/66 (48%), Positives = 45/66 (68%) Frame = +1 Query: 205 ELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 384 ELF V RV KSL+W ++RK F V+ +GF S+ F++ V +A A M+LEV+ALLR Sbjct: 64 ELFPLVSRVFKSLSWSVARKKKFGNWVECHGFSHSISCFRIIVHAFALAGMRLEVWALLR 123 Query: 385 EIVCYC 402 +IV +C Sbjct: 124 DIVGFC 129 >ref|XP_006368375.1| hypothetical protein POPTR_0001s02170g [Populus trichocarpa] gi|550346286|gb|ERP64944.1| hypothetical protein POPTR_0001s02170g [Populus trichocarpa] Length = 697 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = +1 Query: 196 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 375 K EL VV +LK+LNWE++R+V F+++V+ YGF S+ AF+ V V+A A +Q E Sbjct: 22 KRCELSRLVVELLKTLNWEVARQVKFSKSVNVYGFFYSINAFRTIVHVFALAGLQREAQY 81 Query: 376 LLREIVCY 399 LL +IV Y Sbjct: 82 LLTDIVFY 89 >ref|XP_002326536.1| predicted protein [Populus trichocarpa] Length = 697 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/68 (47%), Positives = 46/68 (67%) Frame = +1 Query: 196 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 375 K EL VV +LK+LNWE++R+V F+++V+ YGF S+ AF+ V V+A A +Q E Sbjct: 22 KRCELSRLVVELLKTLNWEVARQVKFSKSVNVYGFFYSINAFRTIVHVFALAGLQREAQY 81 Query: 376 LLREIVCY 399 LL +IV Y Sbjct: 82 LLTDIVFY 89 >ref|XP_004512504.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X1 [Cicer arietinum] gi|502162449|ref|XP_004512505.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X2 [Cicer arietinum] gi|502162452|ref|XP_004512506.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X3 [Cicer arietinum] Length = 666 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/65 (38%), Positives = 44/65 (67%) Frame = +1 Query: 199 SVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYAL 378 + +F VVRV K+LNW ++R++ F V +GF S+ +F++ + +A A M LEV+AL Sbjct: 46 NTRMFHLVVRVFKTLNWSVAREIRFKGWVQSHGFSHSINSFRIIIHTFAFAGMHLEVFAL 105 Query: 379 LREIV 393 +R+++ Sbjct: 106 IRDVL 110 >ref|XP_002527661.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532966|gb|EEF34732.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 766 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/64 (40%), Positives = 40/64 (62%) Frame = +1 Query: 208 LFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLRE 387 LF V+ V K+LNW+++ F + V +GF S+ AFK+ + V A A +Q+EV LR+ Sbjct: 87 LFPFVLTVFKTLNWKLATHTNFFKAVSFHGFSHSIYAFKIIIHVLASAGLQMEVQIFLRD 146 Query: 388 IVCY 399 I+ Y Sbjct: 147 IISY 150