BLASTX nr result
ID: Rehmannia24_contig00028428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028428 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36258.1| hypothetical protein L484_013693 [Morus notabilis] 55 7e-06 >gb|EXB36258.1| hypothetical protein L484_013693 [Morus notabilis] Length = 821 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 3/114 (2%) Frame = -2 Query: 334 YMSKTELDIALGMYHLENQVEYRVERSDKTRFHAICKYERCPFRMRA--YGKDGIWRVGK 161 + +K L + M L+ + +YRV +SDKTR C E C +R+RA Y + +++V K Sbjct: 264 FKNKDTLSRTISMIALKEKYQYRVFKSDKTRIILRCVDENCKWRVRATKYNETDMFQVTK 323 Query: 160 FDKHHGCGLNLNDNASRRVHSKVVGAYFASRLLVE-HSMPVPRDMIVELESRYG 2 +++ H C L+L R+ S+++ + + ++ P ++I +L++ +G Sbjct: 324 YNETHTCSLDLLQCDHRQASSQIISEHIKKKYEESGRTVYAPNNIIEDLKNEFG 377