BLASTX nr result
ID: Rehmannia24_contig00028282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028282 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615833.1| FAR1-related protein [Medicago truncatula] g... 65 1e-08 ref|XP_003623531.1| FAR1-related protein [Medicago truncatula] g... 62 8e-08 >ref|XP_003615833.1| FAR1-related protein [Medicago truncatula] gi|355517168|gb|AES98791.1| FAR1-related protein [Medicago truncatula] Length = 662 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/74 (44%), Positives = 44/74 (59%) Frame = -1 Query: 273 TKKSVLETYCGSTSQLDISVLPPKQAKNKGSGSNLRSRIQSQREKAIKASTKLKR*CGTC 94 TK + LETY + + +LPP+ AK KGSG RI+S +EKA++ K R C C Sbjct: 593 TKTNDLETYIRTNIPERVEILPPQFAKTKGSGK----RIKSGKEKAVEQQQKRTRLCKAC 648 Query: 93 GEIGTHNNRTCPNR 52 GE HN+R CPN+ Sbjct: 649 GEYAHHNSRNCPNK 662 >ref|XP_003623531.1| FAR1-related protein [Medicago truncatula] gi|355498546|gb|AES79749.1| FAR1-related protein [Medicago truncatula] Length = 645 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/74 (41%), Positives = 43/74 (58%) Frame = -1 Query: 273 TKKSVLETYCGSTSQLDISVLPPKQAKNKGSGSNLRSRIQSQREKAIKASTKLKR*CGTC 94 TK + LETY + + +LPP+ AK KGSG RI+S +EK ++ K R C C Sbjct: 576 TKTNDLETYIRTNISEKVEILPPQFAKTKGSGK----RIKSGKEKVVEQQQKRTRLCKAC 631 Query: 93 GEIGTHNNRTCPNR 52 GE H++R CPN+ Sbjct: 632 GEYAHHDSRNCPNK 645