BLASTX nr result
ID: Rehmannia24_contig00028003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028003 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ00266.1| hypothetical protein PRUPE_ppa018685mg [Prunus pe... 59 9e-07 >gb|EMJ00266.1| hypothetical protein PRUPE_ppa018685mg [Prunus persica] Length = 363 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = -3 Query: 403 TKKDDADNMN-SISPKEASSIIDKRDYAEFSAHAKPFAKETKKQHTGPVRKR--NKGADD 233 T+K + D+ +IS + S KRDY EFSA +KP A ET + P +K+ K + D Sbjct: 292 TEKCENDSKGQTISQEGVSKGQTKRDYEEFSADSKPVAYETSEMSASPAKKKVNPKSSVD 351 Query: 232 KQPTLFSYFGRS 197 KQPTLFSYFG+S Sbjct: 352 KQPTLFSYFGKS 363