BLASTX nr result
ID: Rehmannia24_contig00027868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027868 (602 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 138 1e-30 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 138 bits (347), Expect = 1e-30 Identities = 67/203 (33%), Positives = 120/203 (59%), Gaps = 10/203 (4%) Frame = +2 Query: 2 IDDLEKAVVYQRFDQTIREYVDHLKNKKINPVMEFTVPCSRLTPY------NYMPKEYRT 163 ID + K ++++R+D T++E+++HLK + INP+ + +P R P NY+P EYR Sbjct: 61 IDRISKNILHERYDLTLQEWINHLKRETINPIARYPIP-HRQGPTIPSHTANYVPNEYRK 119 Query: 164 LVKSMIEFIVELHLNNDKSLRNFSLDNMVIKHGILKFWKLRFLPATEHRRKADFRCLERV 343 L+KSM+ F+V++H + S F + N+VIK+ ++KFWK++F+ A+ + DF CL RV Sbjct: 120 LIKSMVTFVVDIH-DAGYSTAGFGMPNIVIKNEVVKFWKVQFITASMGSKNNDFICLHRV 178 Query: 344 IKKLFENK----CPPILTDLLTMMTHSQSIDAEKRLPKHLAVLSSPERLAFFKDCFDKRE 511 ++ LF + P + L ++ + E + +H+A++S ER++FF DC++++ Sbjct: 179 VESLFSGEQHLHLPREMQHFLDLLISGTQSEDEYLISRHVAIMSHDERVSFFTDCWERQH 238 Query: 512 DFNLIDKKIYERAVASMGNNSGW 580 + Y+RA +G N W Sbjct: 239 SLPKNQQGCYKRATRGLGRNQNW 261