BLASTX nr result
ID: Rehmannia24_contig00027758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027758 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525147.1| cysteine protease, putative [Ricinus communi... 60 2e-07 >ref|XP_002525147.1| cysteine protease, putative [Ricinus communis] gi|223535606|gb|EEF37274.1| cysteine protease, putative [Ricinus communis] Length = 347 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 9/69 (13%) Frame = -2 Query: 183 MKAPTVMRNYTLAIILLCSLYVSSKAYSETES---------MEKRYRDWLKRYGHKYKSR 31 M+APT+++N L +I LC+L++ S A SE S M+ RY WL++YG KY ++ Sbjct: 1 MEAPTMIKNAGLMLITLCTLWIPSIARSEIHSLPIDSAPTAMKVRYDKWLEQYGRKYDTK 60 Query: 30 DEWNLRFGI 4 DE+ LRFGI Sbjct: 61 DEYLLRFGI 69