BLASTX nr result
ID: Rehmannia24_contig00027704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027704 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73686.1| hypothetical protein M569_01073, partial [Genlise... 60 4e-07 >gb|EPS73686.1| hypothetical protein M569_01073, partial [Genlisea aurea] Length = 240 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 103 MISDPDLIHYACIAKGTIVLAEFNSKDAALGAIA 2 +I DP+LI YACIAKGT+VLAEFNS+DAALGAIA Sbjct: 1 LIMDPNLISYACIAKGTLVLAEFNSRDAALGAIA 34