BLASTX nr result
ID: Rehmannia24_contig00027613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027613 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531197.1| Protein grpE, putative [Ricinus communis] gi... 58 1e-06 ref|XP_002277588.2| PREDICTED: protein grpE-like [Vitis vinifera... 58 1e-06 emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] 58 1e-06 ref|XP_002321532.2| hypothetical protein POPTR_0015s07680g [Popu... 57 3e-06 ref|XP_006374496.1| hypothetical protein POPTR_0015s07680g [Popu... 57 3e-06 gb|EPS72920.1| hypothetical protein M569_01841 [Genlisea aurea] 57 3e-06 ref|XP_003617635.1| GrpE protein-like protein [Medicago truncatu... 55 1e-05 >ref|XP_002531197.1| Protein grpE, putative [Ricinus communis] gi|223529199|gb|EEF31174.1| Protein grpE, putative [Ricinus communis] Length = 308 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 D+SKP VAVVLKAGY+LHDRVIRPAEVGVT + N Sbjct: 266 DSSKPPGTVAVVLKAGYLLHDRVIRPAEVGVTKEVEN 302 >ref|XP_002277588.2| PREDICTED: protein grpE-like [Vitis vinifera] gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 D SKP+ VAVVLKAGY+LHDRVIRPAEVGVT ++N Sbjct: 257 DPSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDN 293 >emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] Length = 413 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 D SKP+ VAVVLKAGY+LHDRVIRPAEVGVT ++N Sbjct: 372 DPSKPSGTVAVVLKAGYMLHDRVIRPAEVGVTQAVDN 408 >ref|XP_002321532.2| hypothetical protein POPTR_0015s07680g [Populus trichocarpa] gi|550322264|gb|EEF05659.2| hypothetical protein POPTR_0015s07680g [Populus trichocarpa] Length = 328 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 DASKP VA VLKAGY+LHDRVIRPAEVGVT + N Sbjct: 286 DASKPPGTVAAVLKAGYMLHDRVIRPAEVGVTREVEN 322 >ref|XP_006374496.1| hypothetical protein POPTR_0015s07680g [Populus trichocarpa] gi|550322263|gb|ERP52293.1| hypothetical protein POPTR_0015s07680g [Populus trichocarpa] Length = 349 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 DASKP VA VLKAGY+LHDRVIRPAEVGVT + N Sbjct: 307 DASKPPGTVAAVLKAGYMLHDRVIRPAEVGVTREVEN 343 >gb|EPS72920.1| hypothetical protein M569_01841 [Genlisea aurea] Length = 296 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVT 214 D SKP VAVVLKAGY+LHDRVIRPAEVGVT Sbjct: 259 DPSKPEGRVAVVLKAGYVLHDRVIRPAEVGVT 290 >ref|XP_003617635.1| GrpE protein-like protein [Medicago truncatula] gi|355518970|gb|AET00594.1| GrpE protein-like protein [Medicago truncatula] Length = 318 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -3 Query: 309 DASKPADHVAVVLKAGYILHDRVIRPAEVGVTVPMNN 199 D SKP VA VLKAGY+LHDRVIRPAEVGVT N Sbjct: 277 DGSKPPGTVAAVLKAGYLLHDRVIRPAEVGVTQAKEN 313