BLASTX nr result
ID: Rehmannia24_contig00026285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026285 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355761.1| PREDICTED: Werner syndrome ATP-dependent hel... 56 6e-06 >ref|XP_006355761.1| PREDICTED: Werner syndrome ATP-dependent helicase-like [Solanum tuberosum] Length = 917 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = -1 Query: 372 EKLKPIKNELSEEVSYSQIKVFLVLQEMGI-LEVISSSHQQGCKVEE 235 EKLKPIK EL EEVSY QIK +L +QE G+ EV SS +Q C +E Sbjct: 728 EKLKPIKTELPEEVSYGQIKAYLTMQEAGVSAEVFSSKSEQSCNEDE 774