BLASTX nr result
ID: Rehmannia24_contig00025830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00025830 (733 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGV54820.1| cell wall-associated hydrolase [Phaseolus vulgaris] 58 2e-07 >gb|AGV54820.1| cell wall-associated hydrolase [Phaseolus vulgaris] Length = 425 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 10/80 (12%) Frame = -3 Query: 278 PA*RKSQHQSSKSFR*CELLGNIYALR--------DSPST*HYRM--ADFVPCSMGRSYS 129 P KS+H+ +K R CELLG I L D PST H R+ ADF PCS G S S Sbjct: 101 PQVAKSRHRGAKPSRRCELLGKISLLSLEQLLSVDDGPSTRHRRITKADFRPCSTGGSCS 160 Query: 128 HSPFGFHTRRPISIRLKQTF 69 +PF TR PIS+ ++TF Sbjct: 161 QAPFCLCTRGPISVWPEETF 180 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 300 NPWDIL*PRVAK 265 NPW+IL P+VAK Sbjct: 94 NPWNILQPQVAK 105