BLASTX nr result
ID: Rehmannia24_contig00025704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00025704 (574 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246563.1| PREDICTED: gamma-tubulin complex component 3... 64 2e-08 ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3... 64 3e-08 gb|EMJ04966.1| hypothetical protein PRUPE_ppa002938mg [Prunus pe... 62 8e-08 ref|XP_004161669.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubuli... 61 2e-07 ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3... 61 2e-07 ref|XP_004303346.1| PREDICTED: gamma-tubulin complex component 3... 60 3e-07 ref|XP_002309295.2| hypothetical protein POPTR_0006s20870g [Popu... 59 7e-07 gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] 59 7e-07 ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3... 59 9e-07 ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citr... 59 9e-07 emb|CBI29999.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3... 57 3e-06 ref|XP_002532346.1| gamma-tubulin complex component, putative [R... 57 3e-06 >ref|XP_004246563.1| PREDICTED: gamma-tubulin complex component 3-like [Solanum lycopersicum] Length = 875 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 468 SQLP+QQHVDLKFLMFRL+FTEFYSQ++P T GKL Sbjct: 840 SQLPVQQHVDLKFLMFRLNFTEFYSQIQPITRGKL 874 >ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3 homolog [Solanum tuberosum] Length = 935 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPSTGGKL 468 SQLP+QQH+DLKFLMFRL+FTEFYSQ++P T GKL Sbjct: 900 SQLPVQQHIDLKFLMFRLNFTEFYSQIQPITRGKL 934 >gb|EMJ04966.1| hypothetical protein PRUPE_ppa002938mg [Prunus persica] Length = 620 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPST 480 S+LP+QQHVDLKFL+FRLDFTEFYSQLRPST Sbjct: 590 SKLPMQQHVDLKFLLFRLDFTEFYSQLRPST 620 >ref|XP_004161669.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubulin complex component 3-like [Cucumis sativus] Length = 846 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRP 486 SQLP+QQHVDLKFL+FRLDFTEFYSQLRP Sbjct: 816 SQLPLQQHVDLKFLLFRLDFTEFYSQLRP 844 >ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3-like [Cucumis sativus] Length = 846 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRP 486 SQLP+QQHVDLKFL+FRLDFTEFYSQLRP Sbjct: 816 SQLPLQQHVDLKFLLFRLDFTEFYSQLRP 844 >ref|XP_004303346.1| PREDICTED: gamma-tubulin complex component 3-like [Fragaria vesca subsp. vesca] Length = 851 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPST 480 S+LP+QQHVDLKFL+FRLDFTEFYSQL PST Sbjct: 821 SKLPMQQHVDLKFLLFRLDFTEFYSQLHPST 851 >ref|XP_002309295.2| hypothetical protein POPTR_0006s20870g [Populus trichocarpa] gi|550336755|gb|EEE92818.2| hypothetical protein POPTR_0006s20870g [Populus trichocarpa] Length = 621 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPST 480 SQLP+QQHVDLKFL FRLDFTEFYS+ RP T Sbjct: 591 SQLPVQQHVDLKFLFFRLDFTEFYSRFRPGT 621 >gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] Length = 878 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLR 489 SQLP+QQH+DLKFLMFRLDFTEFYSQLR Sbjct: 847 SQLPVQQHIDLKFLMFRLDFTEFYSQLR 874 >ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Citrus sinensis] Length = 853 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPS 483 +QLP+QQHVDLKFL+FRLDFTEFY++LRPS Sbjct: 823 AQLPVQQHVDLKFLLFRLDFTEFYTRLRPS 852 >ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] gi|557531963|gb|ESR43146.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] Length = 853 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPS 483 +QLP+QQHVDLKFL+FRLDFTEFY++LRPS Sbjct: 823 AQLPVQQHVDLKFLLFRLDFTEFYTRLRPS 852 >emb|CBI29999.3| unnamed protein product [Vitis vinifera] Length = 777 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPS 483 SQLP+QQH+DLKFL+FRLDFTEFY QL P+ Sbjct: 747 SQLPVQQHIDLKFLLFRLDFTEFYCQLHPN 776 >ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Vitis vinifera] Length = 854 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPS 483 SQLP+QQH+DLKFL+FRLDFTEFY QL P+ Sbjct: 824 SQLPVQQHIDLKFLLFRLDFTEFYCQLHPN 853 >ref|XP_002532346.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223527963|gb|EEF30048.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 855 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 572 SQLPIQQHVDLKFLMFRLDFTEFYSQLRPS 483 SQLP+QQHVDLKFL+FRLDFTEFYS+L P+ Sbjct: 825 SQLPVQQHVDLKFLLFRLDFTEFYSRLCPN 854