BLASTX nr result
ID: Rehmannia24_contig00025245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00025245 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240224.1| PREDICTED: probable sugar phosphate/phosphat... 60 3e-07 >ref|XP_004240224.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like [Solanum lycopersicum] Length = 425 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 163 EFSQSLSPSILG*-VDSFFLTRNLFDLKMSGMKSSGRFFTIGLVTSWYSSNIGVL 2 +F +L P +G V F N++ MS MKSSG+FFTIGLVT+WYSSNIGVL Sbjct: 89 KFKSNLPPKSMGAKVRVFMYPSNIYQFIMSAMKSSGQFFTIGLVTAWYSSNIGVL 143