BLASTX nr result
ID: Rehmannia24_contig00025125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00025125 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627561.1| S-locus-specific glycoprotein [Medicago trun... 58 2e-06 >ref|XP_003627561.1| S-locus-specific glycoprotein [Medicago truncatula] gi|355521583|gb|AET02037.1| S-locus-specific glycoprotein [Medicago truncatula] Length = 835 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 591 EVTVPPPPKLLQALVSGESFRGVGVESGKSVRQEDAGSFDDNVSI 457 EV +PPPPKLLQALV+GESFRGV V+S +V + SF DN+ + Sbjct: 768 EVALPPPPKLLQALVTGESFRGVKVDSSNAVSTAGSSSFCDNMEV 812