BLASTX nr result
ID: Rehmannia24_contig00025047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00025047 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] 65 9e-09 >gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] Length = 257 Score = 65.1 bits (157), Expect = 9e-09 Identities = 43/95 (45%), Positives = 55/95 (57%), Gaps = 5/95 (5%) Frame = -2 Query: 270 MSSFSLCLPSK-IPLILHHR--FNFGFSGNPLYDRHRNPSLFSLSAS--VAERNPNLEVS 106 MSSFSL PSK IP +L R FNF FS L RN S+ SLSA+ + + ++ + Sbjct: 1 MSSFSLRSPSKMIPSVLRSRLYFNF-FSSGCLRVNPRNCSIVSLSAASVAGKSSAGVDFA 59 Query: 105 WNSWDKVAVDDYNGWAITESGPEPVKEKGFRTFAV 1 W SWD ++ D+YNGW E P+ GFR FAV Sbjct: 60 WVSWDGISPDEYNGWDFFEESPD---RNGFRAFAV 91