BLASTX nr result
ID: Rehmannia24_contig00023168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00023168 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71182.1| hypothetical protein M569_03577, partial [Genlise... 68 1e-09 gb|ESW03650.1| hypothetical protein PHAVU_011G031000g [Phaseolus... 57 3e-06 >gb|EPS71182.1| hypothetical protein M569_03577, partial [Genlisea aurea] Length = 608 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +1 Query: 208 GDNSEVSEGEEAEYTFQFQEEMDPLSFAEEEDASGLQPYERFE 336 GD+ VS+ EAEY F+F+ EMDPLSFAE+EDASGLQPYERFE Sbjct: 18 GDDVGVSDDGEAEYEFRFRGEMDPLSFAEDEDASGLQPYERFE 60 >gb|ESW03650.1| hypothetical protein PHAVU_011G031000g [Phaseolus vulgaris] Length = 917 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 235 EEAEYTFQFQEEMDPLSFAEEEDASGLQPYERFERI 342 EE EYTF+FQ MDPL F + D SGLQPYERFER+ Sbjct: 39 EEDEYTFRFQNGMDPLDFIDNNDDSGLQPYERFERL 74