BLASTX nr result
ID: Rehmannia24_contig00022783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00022783 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250136.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 75 1e-11 ref|XP_006353187.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 74 2e-11 gb|EPS64668.1| hypothetical protein M569_10112, partial [Genlise... 73 3e-11 ref|XP_003517707.2| PREDICTED: 6-phosphofructokinase 5, chloropl... 71 1e-10 ref|XP_006346747.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 71 2e-10 ref|XP_004236699.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 71 2e-10 gb|ESW28476.1| hypothetical protein PHAVU_003G289600g [Phaseolus... 70 3e-10 ref|XP_006827209.1| hypothetical protein AMTR_s00010p00259410 [A... 70 3e-10 ref|XP_004509678.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 70 3e-10 ref|XP_003552046.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 70 3e-10 ref|XP_003530616.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 70 3e-10 ref|XP_003628914.1| 6-phosphofructokinase [Medicago truncatula] ... 70 3e-10 ref|XP_006466285.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 69 5e-10 ref|XP_006426295.1| hypothetical protein CICLE_v10025337mg [Citr... 69 5e-10 ref|XP_004489766.1| PREDICTED: 6-phosphofructokinase 5, chloropl... 69 5e-10 ref|XP_002530702.1| phosphofructokinase, putative [Ricinus commu... 69 5e-10 ref|XP_002310313.2| hypothetical protein POPTR_0007s14380g [Popu... 69 7e-10 gb|EOX91973.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao] 69 9e-10 ref|XP_002878619.1| phosphofructokinase family protein [Arabidop... 69 9e-10 ref|XP_006293956.1| hypothetical protein CARUB_v10022950mg [Caps... 68 1e-09 >ref|XP_004250136.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum lycopersicum] Length = 532 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDF+ Sbjct: 500 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFL 532 >ref|XP_006353187.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum tuberosum] Length = 532 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVIAQPK+VDPNSRMWHRCLTSTGQPDF+ Sbjct: 500 FPIPEVIAQPKIVDPNSRMWHRCLTSTGQPDFL 532 >gb|EPS64668.1| hypothetical protein M569_10112, partial [Genlisea aurea] Length = 55 Score = 73.2 bits (178), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVIAQP+V+DPNSRMWHRCLTSTGQPDFI Sbjct: 23 FPIPEVIAQPRVLDPNSRMWHRCLTSTGQPDFI 55 >ref|XP_003517707.2| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine max] Length = 554 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ PK+VDPNSRMWHRCLTSTGQPDFI Sbjct: 522 FPIPEVISHPKLVDPNSRMWHRCLTSTGQPDFI 554 >ref|XP_006346747.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum tuberosum] Length = 537 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI++P+VVDPNSRMWHRCLTSTGQPDF+ Sbjct: 505 FPIPEVISKPRVVDPNSRMWHRCLTSTGQPDFL 537 >ref|XP_004236699.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum lycopersicum] Length = 533 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI++P+VVDPNSRMWHRCLTSTGQPDF+ Sbjct: 501 FPIPEVISKPRVVDPNSRMWHRCLTSTGQPDFL 533 >gb|ESW28476.1| hypothetical protein PHAVU_003G289600g [Phaseolus vulgaris] Length = 534 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P++VDPNSRMWHRCLTSTGQPDFI Sbjct: 502 FPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI 534 >ref|XP_006827209.1| hypothetical protein AMTR_s00010p00259410 [Amborella trichopoda] gi|548831638|gb|ERM94446.1| hypothetical protein AMTR_s00010p00259410 [Amborella trichopoda] Length = 528 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVIA P+ VDPNSRMWHRCLTSTGQPDFI Sbjct: 496 FPIPEVIASPRQVDPNSRMWHRCLTSTGQPDFI 528 >ref|XP_004509678.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer arietinum] Length = 429 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P++VDPNSRMWHRCLTSTGQPDFI Sbjct: 397 FPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI 429 >ref|XP_003552046.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine max] Length = 534 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P++VDPNSRMWHRCLTSTGQPDFI Sbjct: 502 FPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI 534 >ref|XP_003530616.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine max] Length = 532 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P++VDPNSRMWHRCLTSTGQPDFI Sbjct: 500 FPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI 532 >ref|XP_003628914.1| 6-phosphofructokinase [Medicago truncatula] gi|355522936|gb|AET03390.1| 6-phosphofructokinase [Medicago truncatula] Length = 529 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P++VDPNSRMWHRCLTSTGQPDFI Sbjct: 497 FPIPEVISHPRLVDPNSRMWHRCLTSTGQPDFI 529 >ref|XP_006466285.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Citrus sinensis] Length = 532 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P+ VDPNSRMWHRCLTSTGQPDFI Sbjct: 500 FPIPEVISYPRAVDPNSRMWHRCLTSTGQPDFI 532 >ref|XP_006426295.1| hypothetical protein CICLE_v10025337mg [Citrus clementina] gi|557528285|gb|ESR39535.1| hypothetical protein CICLE_v10025337mg [Citrus clementina] Length = 532 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P+ VDPNSRMWHRCLTSTGQPDFI Sbjct: 500 FPIPEVISYPRAVDPNSRMWHRCLTSTGQPDFI 532 >ref|XP_004489766.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer arietinum] Length = 524 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPI EVIA PK+VDPNSRMWHRCLTSTGQPDFI Sbjct: 492 FPITEVIAHPKLVDPNSRMWHRCLTSTGQPDFI 524 >ref|XP_002530702.1| phosphofructokinase, putative [Ricinus communis] gi|223529758|gb|EEF31697.1| phosphofructokinase, putative [Ricinus communis] Length = 431 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P+ VDPNSRMWHRCLTSTGQPDFI Sbjct: 399 FPIPEVISYPRAVDPNSRMWHRCLTSTGQPDFI 431 >ref|XP_002310313.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa] gi|550334868|gb|EEE90763.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa] Length = 532 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P+ VDPNSRMWHRCLTSTGQPDF+ Sbjct: 500 FPIPEVISYPRAVDPNSRMWHRCLTSTGQPDFV 532 >gb|EOX91973.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao] Length = 537 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 382 FPIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 FPIPEVI+ P+ VDPNSRMWHRCLTSTGQPDF+ Sbjct: 505 FPIPEVISHPREVDPNSRMWHRCLTSTGQPDFV 537 >ref|XP_002878619.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297324458|gb|EFH54878.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 537 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 379 PIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 PIPEVIA PK VDPNSRMWHRCLTSTGQPDFI Sbjct: 506 PIPEVIAYPKSVDPNSRMWHRCLTSTGQPDFI 537 >ref|XP_006293956.1| hypothetical protein CARUB_v10022950mg [Capsella rubella] gi|482562664|gb|EOA26854.1| hypothetical protein CARUB_v10022950mg [Capsella rubella] Length = 539 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 379 PIPEVIAQPKVVDPNSRMWHRCLTSTGQPDFI 284 PIPEVIA PK VDPNSRMWHRCLTSTGQPDF+ Sbjct: 508 PIPEVIAYPKSVDPNSRMWHRCLTSTGQPDFL 539