BLASTX nr result
ID: Rehmannia24_contig00022771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00022771 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01088.1| Uncharacterized protein TCM_011040 [Theobroma cacao] 68 1e-09 gb|EMJ27311.1| hypothetical protein PRUPE_ppa014273mg [Prunus pe... 62 6e-08 >gb|EOY01088.1| Uncharacterized protein TCM_011040 [Theobroma cacao] Length = 84 Score = 67.8 bits (164), Expect = 1e-09 Identities = 41/61 (67%), Positives = 44/61 (72%) Frame = -1 Query: 184 DEDVYRGVGIHSQVRKIKQEMEKINHLELQQPPEARPALREIGRYHQRSRSPLGLAEIPI 5 DE Y+GV IHSQV KIKQE EKI H L+Q + R LREI R QRSRSPLGLAE PI Sbjct: 23 DEAGYKGVPIHSQVMKIKQEFEKIKHPSLRQ-ADMRRVLREITR--QRSRSPLGLAERPI 79 Query: 4 S 2 S Sbjct: 80 S 80 >gb|EMJ27311.1| hypothetical protein PRUPE_ppa014273mg [Prunus persica] Length = 77 Score = 62.4 bits (150), Expect = 6e-08 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 3/74 (4%) Frame = -1 Query: 229 STNMPNMDPKKFIDNDEDVYRGVGIHSQVRKIKQEMEKINHLELQQPPE---ARPALREI 59 ++N NMD +E Y GV IHSQV KIKQE EKI H L+QP E R LR+I Sbjct: 12 NSNNRNMD-------EEGSYMGVPIHSQVMKIKQEFEKIKHPSLEQPAELRLRRVLLRQI 64 Query: 58 GRYHQRSRSPLGLA 17 R QRSRSPLGLA Sbjct: 65 TR--QRSRSPLGLA 76