BLASTX nr result
ID: Rehmannia24_contig00022630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00022630 (559 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585... 67 2e-09 ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246... 67 2e-09 ref|XP_006358167.1| PREDICTED: uncharacterized protein LOC102591... 63 6e-08 gb|EPS67188.1| hypothetical protein M569_07585 [Genlisea aurea] 62 7e-08 ref|XP_004235209.1| PREDICTED: uncharacterized protein LOC101249... 62 7e-08 gb|EPS71216.1| hypothetical protein M569_03543, partial [Genlise... 59 8e-07 gb|EMJ19158.1| hypothetical protein PRUPE_ppa005227mg [Prunus pe... 57 2e-06 gb|EMJ19157.1| hypothetical protein PRUPE_ppa005227mg [Prunus pe... 57 2e-06 >ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585852 isoform X1 [Solanum tuberosum] gi|565381923|ref|XP_006357307.1| PREDICTED: uncharacterized protein LOC102585852 isoform X2 [Solanum tuberosum] Length = 480 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 MDGRRITASPRPC GRRVVAKKRPRGG+DG +NS Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNS 34 >ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246351 [Solanum lycopersicum] Length = 480 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 MDGRRITASPRPC GRRVVAKKRPRGG+DG +NS Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNS 34 >ref|XP_006358167.1| PREDICTED: uncharacterized protein LOC102591491 [Solanum tuberosum] Length = 478 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 MDGRRI+ASPRPC GRRVVAKKR RGG+DG +NS Sbjct: 1 MDGRRISASPRPCCGRRVVAKKRSRGGIDGFVNS 34 >gb|EPS67188.1| hypothetical protein M569_07585 [Genlisea aurea] Length = 470 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 M+GRRITASPRPCSGRRV+AKKRPR LDG +NS Sbjct: 1 MEGRRITASPRPCSGRRVLAKKRPRSDLDGFVNS 34 >ref|XP_004235209.1| PREDICTED: uncharacterized protein LOC101249157 [Solanum lycopersicum] Length = 478 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 MDGRRI+ASPRPC GRRVVAKKR RGG+DG +NS Sbjct: 1 MDGRRISASPRPCCGRRVVAKKRSRGGVDGFVNS 34 >gb|EPS71216.1| hypothetical protein M569_03543, partial [Genlisea aurea] Length = 236 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 103 MDGRRITASPRPCSGRRVVAKKRPRGGLDGSINS 2 M+GRRI+A+PRPC GRRVVAKKRPR LDG +NS Sbjct: 1 MEGRRISATPRPCFGRRVVAKKRPRSALDGFVNS 34 >gb|EMJ19158.1| hypothetical protein PRUPE_ppa005227mg [Prunus persica] Length = 471 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -1 Query: 97 GRRITASPRPCSGRRVVAKKRPR-GGLDGSINS 2 GRRI+ASPRPC+GRRVVAKKRPR GG+DG +NS Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRVGGVDGFVNS 36 >gb|EMJ19157.1| hypothetical protein PRUPE_ppa005227mg [Prunus persica] Length = 470 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = -1 Query: 97 GRRITASPRPCSGRRVVAKKRPR-GGLDGSINS 2 GRRI+ASPRPC+GRRVVAKKRPR GG+DG +NS Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRVGGVDGFVNS 36