BLASTX nr result
ID: Rehmannia24_contig00022589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00022589 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266564.2| PREDICTED: uncharacterized protein LOC100266... 60 2e-07 >ref|XP_002266564.2| PREDICTED: uncharacterized protein LOC100266871 [Vitis vinifera] Length = 460 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 249 HRRGHTWSFATFSGLKNTWKHQNHRAQAMSTSQGNLASPRGSANMEDKPDH 401 HR+G TFSG+ +TWKH++ RAQAMST+QGN ASPRG + + +PDH Sbjct: 55 HRQG-----LTFSGINSTWKHKSLRAQAMSTTQGNAASPRGFMHGKYEPDH 100