BLASTX nr result
ID: Rehmannia24_contig00022168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00022168 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305961.2| hypothetical protein POPTR_0004s10440g [Popu... 56 6e-06 >ref|XP_002305961.2| hypothetical protein POPTR_0004s10440g [Populus trichocarpa] gi|550340745|gb|EEE86472.2| hypothetical protein POPTR_0004s10440g [Populus trichocarpa] Length = 380 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +2 Query: 263 SSFPSGSLNQQPRRRVASKSGSFAARPCRQQSFGREIGHAAAETYL 400 SS SGS NQ RRRV+ K G +P RQQSF R+IGHAAAETYL Sbjct: 41 SSVSSGSFNQMQRRRVSGKLG----KPGRQQSFSRDIGHAAAETYL 82