BLASTX nr result
ID: Rehmannia24_contig00021780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00021780 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutr... 67 2e-09 ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutr... 67 2e-09 ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thal... 65 9e-09 ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidops... 65 9e-09 emb|CAB71090.1| putative protein [Arabidopsis thaliana] 65 9e-09 ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thal... 65 1e-08 ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutr... 64 2e-08 ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutr... 64 2e-08 ref|XP_002880228.1| BTB/POZ domain-containing protein [Arabidops... 64 2e-08 gb|EOY24916.1| POZ/BTB containin G-protein 1 isoform 4 [Theobrom... 64 2e-08 gb|EOY24915.1| POZ/BTB containin G-protein 1 isoform 3 [Theobrom... 64 2e-08 gb|EOY24914.1| POZ/BTB containin G-protein 1 isoform 2 [Theobrom... 64 2e-08 gb|EOY24913.1| POZ/BTB containin G-protein 1 isoform 1 [Theobrom... 64 2e-08 ref|XP_004231198.1| PREDICTED: uncharacterized protein LOC101266... 64 2e-08 ref|XP_002301391.1| BTB/POZ domain-containing family protein [Po... 63 5e-08 dbj|BAD94357.1| hypothetical protein [Arabidopsis thaliana] 63 5e-08 ref|NP_566069.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thali... 63 5e-08 gb|AAM61110.1| unknown [Arabidopsis thaliana] 63 5e-08 ref|XP_006339663.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 gb|EPS73437.1| hypothetical protein M569_01319, partial [Genlise... 62 8e-08 >ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098886|gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 554 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCL 277 RNLFG PWT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 517 RNLFGCPWTSFIADDSQYFINGILHLRAELTIKRSTDL 554 >ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098885|gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 530 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCL 277 RNLFG PWT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 493 RNLFGCPWTSFIADDSQYFINGILHLRAELTIKRSTDL 530 >ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] gi|327488374|sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 gi|332646708|gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] Length = 561 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 283 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 524 RNLFGVPWTSFIAEDSQYFINGILHLRAELTIKRST 559 >ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322462|gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 562 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 283 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 525 RNLFGVPWTSFIAEDSQYFINGILHLRAELTIKRST 560 >emb|CAB71090.1| putative protein [Arabidopsis thaliana] Length = 545 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 283 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 508 RNLFGVPWTSFIAEDSQYFINGILHLRAELTIKRST 543 >ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] gi|12006855|gb|AAG44951.1|AF292397_1 POZ/BTB containing-protein AtPOB1 [Arabidopsis thaliana] gi|133778840|gb|ABO38760.1| At3g61600 [Arabidopsis thaliana] gi|332646709|gb|AEE80230.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] Length = 561 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ Sbjct: 524 RNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR 557 >ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103565|gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 613 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 283 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 575 RNLFGIPWTSFIAEDSLYFINGILHLRAELTIKRST 610 >ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103564|gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 603 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 283 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 565 RNLFGIPWTSFIAEDSLYFINGILHLRAELTIKRST 600 >ref|XP_002880228.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297326067|gb|EFH56487.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT+FIADDS +FING+LHLRAELTIK+ Sbjct: 523 RNLFGIPWTSFIADDSQHFINGILHLRAELTIKR 556 >gb|EOY24916.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] Length = 473 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWTAF+ADDS YFING+LHLRAELTI++ Sbjct: 440 RNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ 473 >gb|EOY24915.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] Length = 461 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWTAF+ADDS YFING+LHLRAELTI++ Sbjct: 428 RNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ 461 >gb|EOY24914.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] Length = 460 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWTAF+ADDS YFING+LHLRAELTI++ Sbjct: 427 RNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ 460 >gb|EOY24913.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] Length = 564 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWTAF+ADDS YFING+LHLRAELTI++ Sbjct: 531 RNLFGIPWTAFMADDSIYFINGILHLRAELTIRQ 564 >ref|XP_004231198.1| PREDICTED: uncharacterized protein LOC101266876 [Solanum lycopersicum] Length = 1147 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLF PWT+FIA+DSPYF NG+LHLRAELTIKK Sbjct: 518 RNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIKK 551 >ref|XP_002301391.1| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|222843117|gb|EEE80664.1| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 556 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIK 292 RNLF PWT+F+A+DSPYFINGVLHLRAELTI+ Sbjct: 523 RNLFAIPWTSFMAEDSPYFINGVLHLRAELTIR 555 >dbj|BAD94357.1| hypothetical protein [Arabidopsis thaliana] Length = 318 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT+FIA+DS +FING+LHLRAELTIK+ Sbjct: 280 RNLFGIPWTSFIAEDSQHFINGILHLRAELTIKR 313 >ref|NP_566069.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana] gi|75220239|sp|O82343.2|Y2626_ARATH RecName: Full=BTB/POZ domain-containing protein At2g46260 gi|15028123|gb|AAK76685.1| unknown protein [Arabidopsis thaliana] gi|19310797|gb|AAL85129.1| unknown protein [Arabidopsis thaliana] gi|20197378|gb|AAC62880.2| expressed protein [Arabidopsis thaliana] gi|330255572|gb|AEC10666.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana] Length = 561 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT+FIA+DS +FING+LHLRAELTIK+ Sbjct: 523 RNLFGIPWTSFIAEDSQHFINGILHLRAELTIKR 556 >gb|AAM61110.1| unknown [Arabidopsis thaliana] Length = 546 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT+FIA+DS +FING+LHLRAELTIK+ Sbjct: 508 RNLFGIPWTSFIAEDSQHFINGILHLRAELTIKR 541 >ref|XP_006339663.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum tuberosum] Length = 552 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIK 292 RNLF PWT+FIA+DSPYF NG+LHLRAELTIK Sbjct: 519 RNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK 551 >gb|EPS73437.1| hypothetical protein M569_01319, partial [Genlisea aurea] Length = 475 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -3 Query: 390 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 289 RNLFG PWT FIA DS YFING LHLRAELTIKK Sbjct: 442 RNLFGLPWTEFIAADSSYFINGFLHLRAELTIKK 475