BLASTX nr result
ID: Rehmannia24_contig00021469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00021469 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67673.1| WD repeat-containing protein 48 [Morus notabilis] 84 1e-14 ref|XP_006577271.1| PREDICTED: WD repeat-containing protein 48-l... 84 3e-14 ref|XP_006577270.1| PREDICTED: WD repeat-containing protein 48-l... 84 3e-14 ref|XP_006577268.1| PREDICTED: WD repeat-containing protein 48-l... 84 3e-14 ref|XP_003633666.1| PREDICTED: WD repeat-containing protein 48 h... 84 3e-14 emb|CBI34238.3| unnamed protein product [Vitis vinifera] 84 3e-14 ref|XP_002271491.1| PREDICTED: WD repeat-containing protein 48 h... 84 3e-14 gb|EMJ08339.1| hypothetical protein PRUPE_ppa001805mg [Prunus pe... 82 7e-14 ref|XP_006389301.1| hypothetical protein POPTR_0030s00210g [Popu... 82 1e-13 ref|XP_006389300.1| hypothetical protein POPTR_0030s00210g [Popu... 82 1e-13 ref|XP_002328525.1| predicted protein [Populus trichocarpa] gi|5... 82 1e-13 ref|XP_006854552.1| hypothetical protein AMTR_s00030p00083820 [A... 81 1e-13 ref|XP_004302002.1| PREDICTED: WD repeat-containing protein 48 h... 81 2e-13 ref|XP_002512270.1| nucleotide binding protein, putative [Ricinu... 81 2e-13 ref|XP_006433088.1| hypothetical protein CICLE_v10000367mg [Citr... 80 2e-13 ref|XP_006347820.1| PREDICTED: WD repeat-containing protein 48-l... 80 3e-13 ref|XP_006577269.1| PREDICTED: WD repeat-containing protein 48-l... 80 4e-13 ref|XP_003626373.1| WD repeat-containing protein-like protein [M... 79 5e-13 gb|ESW19121.1| hypothetical protein PHAVU_006G0982001g, partial ... 79 8e-13 gb|ESW19117.1| hypothetical protein PHAVU_006G097800g [Phaseolus... 79 8e-13 >gb|EXB67673.1| WD repeat-containing protein 48 [Morus notabilis] Length = 764 Score = 84.3 bits (207), Expect = 1e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 136 AMHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 AMHRVGSAGN +NS R RKEKRLTYVLNDAD+TKHCAGINCLA+L Sbjct: 22 AMHRVGSAGNTANSTRPRKEKRLTYVLNDADDTKHCAGINCLALL 66 >ref|XP_006577271.1| PREDICTED: WD repeat-containing protein 48-like isoform X4 [Glycine max] Length = 707 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 145 TILAMHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 T+ AMHRVGSA N +NS RSRKEKR+TYVLND+D+TKHCAGINCLA+L Sbjct: 4 TVSAMHRVGSASNGNNSTRSRKEKRITYVLNDSDDTKHCAGINCLALL 51 >ref|XP_006577270.1| PREDICTED: WD repeat-containing protein 48-like isoform X3 [Glycine max] Length = 758 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 145 TILAMHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 T+ AMHRVGSA N +NS RSRKEKR+TYVLND+D+TKHCAGINCLA+L Sbjct: 4 TVSAMHRVGSASNGNNSTRSRKEKRITYVLNDSDDTKHCAGINCLALL 51 >ref|XP_006577268.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Glycine max] Length = 771 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 145 TILAMHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 T+ AMHRVGSA N +NS RSRKEKR+TYVLND+D+TKHCAGINCLA+L Sbjct: 4 TVSAMHRVGSASNGNNSTRSRKEKRITYVLNDSDDTKHCAGINCLALL 51 >ref|XP_003633666.1| PREDICTED: WD repeat-containing protein 48 homolog isoform 2 [Vitis vinifera] Length = 733 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAV 5 MHRVGSAGN SNS R RKEKRLTYVLNDAD+TKHCAGINCLAV Sbjct: 1 MHRVGSAGNTSNSTRPRKEKRLTYVLNDADDTKHCAGINCLAV 43 >emb|CBI34238.3| unnamed protein product [Vitis vinifera] Length = 781 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAV 5 MHRVGSAGN SNS R RKEKRLTYVLNDAD+TKHCAGINCLAV Sbjct: 1 MHRVGSAGNTSNSTRPRKEKRLTYVLNDADDTKHCAGINCLAV 43 >ref|XP_002271491.1| PREDICTED: WD repeat-containing protein 48 homolog isoform 1 [Vitis vinifera] Length = 765 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAV 5 MHRVGSAGN SNS R RKEKRLTYVLNDAD+TKHCAGINCLAV Sbjct: 1 MHRVGSAGNTSNSTRPRKEKRLTYVLNDADDTKHCAGINCLAV 43 >gb|EMJ08339.1| hypothetical protein PRUPE_ppa001805mg [Prunus persica] Length = 763 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN +NS R RKEKRLTYVL+DAD+TKHCAGINCLAVL Sbjct: 1 MHRVGSAGNTANSTRPRKEKRLTYVLSDADDTKHCAGINCLAVL 44 >ref|XP_006389301.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] gi|550312061|gb|ERP48215.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] Length = 689 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN +NSVR RKEKRLTYVL+DAD+TKHCAGINCL VL Sbjct: 1 MHRVGSAGNTNNSVRPRKEKRLTYVLSDADDTKHCAGINCLKVL 44 >ref|XP_006389300.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] gi|550312060|gb|ERP48214.1| hypothetical protein POPTR_0030s00210g [Populus trichocarpa] Length = 745 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN +NSVR RKEKRLTYVL+DAD+TKHCAGINCL VL Sbjct: 1 MHRVGSAGNTNNSVRPRKEKRLTYVLSDADDTKHCAGINCLKVL 44 >ref|XP_002328525.1| predicted protein [Populus trichocarpa] gi|566169511|ref|XP_006382725.1| hypothetical protein POPTR_0005s04800g [Populus trichocarpa] gi|550338092|gb|ERP60522.1| hypothetical protein POPTR_0005s04800g [Populus trichocarpa] Length = 761 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN +NSVR RKEKRLTYVL+DAD+TKHCAGINCL VL Sbjct: 1 MHRVGSAGNTTNSVRPRKEKRLTYVLSDADDTKHCAGINCLKVL 44 >ref|XP_006854552.1| hypothetical protein AMTR_s00030p00083820 [Amborella trichopoda] gi|548858238|gb|ERN16019.1| hypothetical protein AMTR_s00030p00083820 [Amborella trichopoda] Length = 763 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGS GN SNS R RKEKRLTYVLNDAD+T HCAGINCLAVL Sbjct: 1 MHRVGSTGNTSNSTRPRKEKRLTYVLNDADDTTHCAGINCLAVL 44 >ref|XP_004302002.1| PREDICTED: WD repeat-containing protein 48 homolog [Fragaria vesca subsp. vesca] Length = 760 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN SNS R RKEKRLTYVL+DAD+ KHCAGINCLAVL Sbjct: 1 MHRVGSAGNTSNSTRPRKEKRLTYVLSDADDRKHCAGINCLAVL 44 >ref|XP_002512270.1| nucleotide binding protein, putative [Ricinus communis] gi|223548231|gb|EEF49722.1| nucleotide binding protein, putative [Ricinus communis] Length = 764 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN S+SVR RKEKRLTYVLNDAD+ KHC+G+NCLAVL Sbjct: 1 MHRVGSAGNTSSSVRPRKEKRLTYVLNDADDKKHCSGVNCLAVL 44 >ref|XP_006433088.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] gi|567881061|ref|XP_006433089.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] gi|567881063|ref|XP_006433090.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] gi|568835446|ref|XP_006471782.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Citrus sinensis] gi|557535210|gb|ESR46328.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] gi|557535211|gb|ESR46329.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] gi|557535212|gb|ESR46330.1| hypothetical protein CICLE_v10000367mg [Citrus clementina] Length = 763 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSAGN +NS R RKEKRLTYVLN++D+TKHCAGINCLAVL Sbjct: 1 MHRVGSAGNNANSTRPRKEKRLTYVLNNSDDTKHCAGINCLAVL 44 >ref|XP_006347820.1| PREDICTED: WD repeat-containing protein 48-like isoform X1 [Solanum tuberosum] gi|565362165|ref|XP_006347821.1| PREDICTED: WD repeat-containing protein 48-like isoform X2 [Solanum tuberosum] gi|565362167|ref|XP_006347822.1| PREDICTED: WD repeat-containing protein 48-like isoform X3 [Solanum tuberosum] gi|565362169|ref|XP_006347823.1| PREDICTED: WD repeat-containing protein 48-like isoform X4 [Solanum tuberosum] gi|565362171|ref|XP_006347824.1| PREDICTED: WD repeat-containing protein 48-like isoform X5 [Solanum tuberosum] gi|565362173|ref|XP_006347825.1| PREDICTED: WD repeat-containing protein 48-like isoform X6 [Solanum tuberosum] Length = 763 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRV SAGN SNSVR RKEKRLTYVLNDAD+TKHCAG+N LAVL Sbjct: 1 MHRVASAGNTSNSVRPRKEKRLTYVLNDADDTKHCAGVNSLAVL 44 >ref|XP_006577269.1| PREDICTED: WD repeat-containing protein 48-like isoform X2 [Glycine max] Length = 764 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSA N +NS RSRKEKR+TYVLND+D+TKHCAGINCLA+L Sbjct: 1 MHRVGSASNGNNSTRSRKEKRITYVLNDSDDTKHCAGINCLALL 44 >ref|XP_003626373.1| WD repeat-containing protein-like protein [Medicago truncatula] gi|355501388|gb|AES82591.1| WD repeat-containing protein-like protein [Medicago truncatula] Length = 783 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 136 AMHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 AMHRV S GN +NS R RKEKRLTYVLND+D+TKHCAGINCLA+L Sbjct: 5 AMHRVASTGNANNSTRPRKEKRLTYVLNDSDDTKHCAGINCLALL 49 >gb|ESW19121.1| hypothetical protein PHAVU_006G0982001g, partial [Phaseolus vulgaris] gi|561020351|gb|ESW19122.1| hypothetical protein PHAVU_006G0982001g, partial [Phaseolus vulgaris] Length = 458 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSA N +NS R RKEKRLTYVLND+D+TKHCAGINCLA+L Sbjct: 1 MHRVGSASNGNNSTRPRKEKRLTYVLNDSDDTKHCAGINCLALL 44 >gb|ESW19117.1| hypothetical protein PHAVU_006G097800g [Phaseolus vulgaris] Length = 761 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 133 MHRVGSAGNMSNSVRSRKEKRLTYVLNDADNTKHCAGINCLAVL 2 MHRVGSA N +NS R RKEKRLTYVLND+D+TKHCAGINCLA+L Sbjct: 1 MHRVGSASNGNNSTRPRKEKRLTYVLNDSDDTKHCAGINCLALL 44