BLASTX nr result
ID: Rehmannia24_contig00021298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00021298 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01... 69 8e-10 ref|XP_004238198.1| PREDICTED: B3 domain-containing protein LOC_... 64 3e-08 emb|CBI19591.3| unnamed protein product [Vitis vinifera] 55 7e-06 >ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum tuberosum] Length = 113 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -1 Query: 141 MWNTRRPHFLMGFDPSLCSERLNIPCNFVKYMEGRAPGTSLLVGPSG 1 M + RRPHFL+GF+PS+ SE+L IP F+K+MEGR GT++LVGPSG Sbjct: 1 MLDARRPHFLVGFNPSMNSEKLKIPSKFIKHMEGRDSGTTVLVGPSG 47 >ref|XP_004238198.1| PREDICTED: B3 domain-containing protein LOC_Os12g40080-like [Solanum lycopersicum] Length = 580 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 141 MWNTRRPHFLMGFDPSLCSERLNIPCNFVKYMEGRAPGTSLLVGPSG 1 M + RRPHFL+GF+P + SE+L IP F+K+MEG GT++LVGPSG Sbjct: 1 MLDARRPHFLVGFNPFMNSEKLKIPSKFIKHMEGGDSGTTVLVGPSG 47 >emb|CBI19591.3| unnamed protein product [Vitis vinifera] Length = 604 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = -1 Query: 141 MWNTRRPHFLMGFDPSLCSERLNIPCNFVKYMEGRAPGTSLLVGPS 4 M N++RPHF F P SERL IP F+K+MEGR G LVGPS Sbjct: 1 MKNSKRPHFFEVFQPDASSERLKIPSRFIKHMEGRTSGFVSLVGPS 46