BLASTX nr result
ID: Rehmannia24_contig00021129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00021129 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB41569.1| U4/U6.U5 tri-snRNP-associated protein 2 [Morus no... 73 4e-11 ref|XP_006491511.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 73 4e-11 ref|XP_006856873.1| hypothetical protein AMTR_s00055p00194180 [A... 73 4e-11 gb|EOY28881.1| Ubiquitin C-terminal hydrolases superfamily prote... 73 4e-11 ref|XP_004293359.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 73 4e-11 ref|XP_002322534.1| hypothetical protein POPTR_0016s01560g [Popu... 72 1e-10 ref|XP_006421203.1| hypothetical protein CICLE_v10004667mg [Citr... 71 1e-10 gb|EMJ15147.1| hypothetical protein PRUPE_ppa003586mg [Prunus pe... 71 1e-10 ref|XP_004167152.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 71 1e-10 ref|XP_004139540.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 71 1e-10 ref|XP_002520562.1| ubiquitin specific protease 39 and snrnp ass... 71 1e-10 ref|XP_002308779.1| hypothetical protein POPTR_0006s01170g [Popu... 71 1e-10 emb|CAN83206.1| hypothetical protein VITISV_019937 [Vitis vinifera] 71 1e-10 ref|XP_002969088.1| hypothetical protein SELMODRAFT_90860 [Selag... 70 2e-10 ref|XP_006364992.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 69 5e-10 ref|XP_004233260.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 69 5e-10 ref|XP_006594222.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 68 1e-09 ref|XP_006588844.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 68 1e-09 ref|XP_006588843.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 68 1e-09 gb|ESW16386.1| hypothetical protein PHAVU_007G152400g [Phaseolus... 68 1e-09 >gb|EXB41569.1| U4/U6.U5 tri-snRNP-associated protein 2 [Morus notabilis] Length = 564 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ Sbjct: 531 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 564 >ref|XP_006491511.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Citrus sinensis] Length = 554 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ Sbjct: 521 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 554 >ref|XP_006856873.1| hypothetical protein AMTR_s00055p00194180 [Amborella trichopoda] gi|548860807|gb|ERN18340.1| hypothetical protein AMTR_s00055p00194180 [Amborella trichopoda] Length = 544 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ Sbjct: 510 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 543 >gb|EOY28881.1| Ubiquitin C-terminal hydrolases superfamily protein [Theobroma cacao] Length = 557 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ Sbjct: 524 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 557 >ref|XP_004293359.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Fragaria vesca subsp. vesca] Length = 534 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ Sbjct: 501 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 534 >ref|XP_002322534.1| hypothetical protein POPTR_0016s01560g [Populus trichocarpa] gi|222867164|gb|EEF04295.1| hypothetical protein POPTR_0016s01560g [Populus trichocarpa] Length = 530 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAY+QIYEQQQ Sbjct: 497 EELWYEMQDLHVSETLPQMVALSEAYLQIYEQQQ 530 >ref|XP_006421203.1| hypothetical protein CICLE_v10004667mg [Citrus clementina] gi|557523076|gb|ESR34443.1| hypothetical protein CICLE_v10004667mg [Citrus clementina] Length = 554 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSE YMQIYEQQQ Sbjct: 521 EELWYEMQDLHVSETLPQMVALSETYMQIYEQQQ 554 >gb|EMJ15147.1| hypothetical protein PRUPE_ppa003586mg [Prunus persica] Length = 564 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSE YMQIYEQQQ Sbjct: 531 EELWYEMQDLHVSETLPQMVALSETYMQIYEQQQ 564 >ref|XP_004167152.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Cucumis sativus] Length = 550 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYE+QQ Sbjct: 517 EELWYEMQDLHVSETLPQMVALSEAYMQIYERQQ 550 >ref|XP_004139540.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Cucumis sativus] Length = 550 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAYMQIYE+QQ Sbjct: 517 EELWYEMQDLHVSETLPQMVALSEAYMQIYERQQ 550 >ref|XP_002520562.1| ubiquitin specific protease 39 and snrnp assembly factor, putative [Ricinus communis] gi|223540222|gb|EEF41795.1| ubiquitin specific protease 39 and snrnp assembly factor, putative [Ricinus communis] Length = 557 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAY+QIYEQQQ Sbjct: 524 EELWYEMQDLHVSETLPQMVALSEAYVQIYEQQQ 557 >ref|XP_002308779.1| hypothetical protein POPTR_0006s01170g [Populus trichocarpa] gi|222854755|gb|EEE92302.1| hypothetical protein POPTR_0006s01170g [Populus trichocarpa] Length = 557 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSEAY+QIYEQQQ Sbjct: 524 EELWYEMQDLHVSETLPQMVALSEAYVQIYEQQQ 557 >emb|CAN83206.1| hypothetical protein VITISV_019937 [Vitis vinifera] Length = 566 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSE YMQIYEQQQ Sbjct: 533 EELWYEMQDLHVSETLPQMVALSETYMQIYEQQQ 566 >ref|XP_002969088.1| hypothetical protein SELMODRAFT_90860 [Selaginella moellendorffii] gi|302784408|ref|XP_002973976.1| hypothetical protein SELMODRAFT_100186 [Selaginella moellendorffii] gi|300158308|gb|EFJ24931.1| hypothetical protein SELMODRAFT_100186 [Selaginella moellendorffii] gi|300163593|gb|EFJ30204.1| hypothetical protein SELMODRAFT_90860 [Selaginella moellendorffii] Length = 458 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EE+WYEMQDLHV+ETLPQMVALSEAYMQIYEQQQ Sbjct: 425 EEVWYEMQDLHVTETLPQMVALSEAYMQIYEQQQ 458 >ref|XP_006364992.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Solanum tuberosum] Length = 551 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSE YMQIYEQ Q Sbjct: 517 EELWYEMQDLHVSETLPQMVALSETYMQIYEQHQ 550 >ref|XP_004233260.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Solanum lycopersicum] Length = 551 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLPQMVALSE YMQIYEQ Q Sbjct: 517 EELWYEMQDLHVSETLPQMVALSETYMQIYEQHQ 550 >ref|XP_006594222.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like isoform X3 [Glycine max] Length = 546 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLP +VALSE YMQIYEQQQ Sbjct: 513 EELWYEMQDLHVSETLPHLVALSETYMQIYEQQQ 546 >ref|XP_006588844.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like isoform X2 [Glycine max] Length = 568 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLP +VALSE YMQIYEQQQ Sbjct: 535 EELWYEMQDLHVSETLPHLVALSETYMQIYEQQQ 568 >ref|XP_006588843.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like isoform X1 [Glycine max] Length = 585 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLP +VALSE YMQIYEQQQ Sbjct: 552 EELWYEMQDLHVSETLPHLVALSETYMQIYEQQQ 585 >gb|ESW16386.1| hypothetical protein PHAVU_007G152400g [Phaseolus vulgaris] gi|561017583|gb|ESW16387.1| hypothetical protein PHAVU_007G152400g [Phaseolus vulgaris] Length = 568 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 400 EELWYEMQDLHVSETLPQMVALSEAYMQIYEQQQ 299 EELWYEMQDLHVSETLP +VALSE YMQIYEQQQ Sbjct: 535 EELWYEMQDLHVSETLPHLVALSETYMQIYEQQQ 568