BLASTX nr result
ID: Rehmannia24_contig00020450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00020450 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 gb|EPS62186.1| hypothetical protein M569_12607 [Genlisea aurea] 74 3e-11 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 74 3e-11 gb|EXB93901.1| hypothetical protein L484_002057 [Morus notabilis] 73 5e-11 ref|XP_004299145.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 gb|EAY77393.1| hypothetical protein OsI_05381 [Oryza sativa Indi... 70 3e-10 ref|NP_001045530.1| Os01g0970900 [Oryza sativa Japonica Group] g... 70 3e-10 ref|XP_006645333.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006476892.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_006439927.1| hypothetical protein CICLE_v10019266mg [Citr... 67 2e-09 gb|AFW83859.1| hypothetical protein ZEAMMB73_953172 [Zea mays] 66 4e-09 gb|ACG29979.1| hypothetical protein [Zea mays] 66 4e-09 ref|NP_001132329.1| uncharacterized protein LOC100193771 [Zea ma... 66 4e-09 gb|EMJ11699.1| hypothetical protein PRUPE_ppa002676mg [Prunus pe... 65 7e-09 ref|XP_004971408.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_004515865.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 >ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 642 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AYQHVF+SFF EGRHSEAKDLLYKCPHHIR+HPA+C LFGS+ Sbjct: 583 AYQHVFQSFFAEGRHSEAKDLLYKCPHHIRQHPAICGLFGSS 624 >ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Solanum lycopersicum] Length = 642 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AYQHVF+SFF EGRHSEAKDLLYKCP+HIR+HPA+C LFGS+ Sbjct: 583 AYQHVFQSFFAEGRHSEAKDLLYKCPYHIRQHPAICGLFGSS 624 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AY HVF+SFF EGR SEAKDLLYKCPHHIRKHP +C LFGSA Sbjct: 581 AYVHVFESFFQEGRESEAKDLLYKCPHHIRKHPDICKLFGSA 622 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AY H+F SFF+EGR+SEAKDLL+KCPHHIRKH VC LFGSA Sbjct: 574 AYLHIFNSFFNEGRYSEAKDLLFKCPHHIRKHNEVCKLFGSA 615 >gb|EPS62186.1| hypothetical protein M569_12607 [Genlisea aurea] Length = 627 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLF 243 +Y+HVF +F +E RHSEAKDLL++CPHH+RKHPAVCSLF Sbjct: 585 SYRHVFGAFLNENRHSEAKDLLFRCPHHVRKHPAVCSLF 623 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AY +VF+SFF GRHSEAKDLL+KCPHHIRKHP + LFGSA Sbjct: 579 AYLNVFQSFFRAGRHSEAKDLLFKCPHHIRKHPKISELFGSA 620 >gb|EXB93901.1| hypothetical protein L484_002057 [Morus notabilis] Length = 628 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY H+F+SFF EGRHSEAKDLL+KCPHHIRKH + LFGS Sbjct: 580 AYFHIFESFFREGRHSEAKDLLFKCPHHIRKHRDIAKLFGS 620 >ref|XP_004299145.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 630 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HVFKSFF EGRHSEAKDLLYKCPHHIRK V LFG+ Sbjct: 580 AYVHVFKSFFKEGRHSEAKDLLYKCPHHIRKLGEVRKLFGA 620 >gb|EAY77393.1| hypothetical protein OsI_05381 [Oryza sativa Indica Group] Length = 573 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HVFKSFF EGR+SEA+DLLYKCP HIRKHP V LF S Sbjct: 524 AYLHVFKSFFTEGRYSEAQDLLYKCPFHIRKHPDVTELFES 564 >ref|NP_001045530.1| Os01g0970900 [Oryza sativa Japonica Group] gi|15289974|dbj|BAB63669.1| pentatricopeptide (PPR) repeat-containing protein -like [Oryza sativa Japonica Group] gi|113535061|dbj|BAF07444.1| Os01g0970900 [Oryza sativa Japonica Group] gi|125573469|gb|EAZ14984.1| hypothetical protein OsJ_04919 [Oryza sativa Japonica Group] gi|215678751|dbj|BAG95188.1| unnamed protein product [Oryza sativa Japonica Group] gi|215693250|dbj|BAG88632.1| unnamed protein product [Oryza sativa Japonica Group] Length = 573 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HVFKSFF EGR+SEA+DLLYKCP HIRKHP V LF S Sbjct: 524 AYLHVFKSFFTEGRYSEAQDLLYKCPFHIRKHPDVTELFES 564 >ref|XP_006645333.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Oryza brachyantha] Length = 562 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HVF+SFF EGR+SEA+DLLYKCP HIRKHP V LF S Sbjct: 515 AYLHVFESFFTEGRYSEAQDLLYKCPIHIRKHPDVTKLFES 555 >ref|XP_006476892.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Citrus sinensis] Length = 639 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AY VF+SFF+EGRH EAKDLLYKCPHHIR+ + LFGSA Sbjct: 582 AYLQVFESFFNEGRHYEAKDLLYKCPHHIRQDSKISLLFGSA 623 >ref|XP_006439927.1| hypothetical protein CICLE_v10019266mg [Citrus clementina] gi|557542189|gb|ESR53167.1| hypothetical protein CICLE_v10019266mg [Citrus clementina] Length = 639 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 AY VF+SFF+EGRH EAKDLLYKCPHHIR+ + LFGSA Sbjct: 582 AYLQVFESFFNEGRHYEAKDLLYKCPHHIRQDSKISLLFGSA 623 >gb|AFW83859.1| hypothetical protein ZEAMMB73_953172 [Zea mays] Length = 598 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HV K FF EGR+SEA+DLLY CP+HIRKHP V LFGS Sbjct: 542 AYLHVLKLFFAEGRYSEAQDLLYGCPNHIRKHPDVIKLFGS 582 >gb|ACG29979.1| hypothetical protein [Zea mays] Length = 577 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HV K FF EGR+SEA+DLLY CP+HIRKHP V LFGS Sbjct: 521 AYLHVLKLFFAEGRYSEAQDLLYGCPNHIRKHPDVIKLFGS 561 >ref|NP_001132329.1| uncharacterized protein LOC100193771 [Zea mays] gi|194694094|gb|ACF81131.1| unknown [Zea mays] Length = 502 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HV K FF EGR+SEA+DLLY CP+HIRKHP V LFGS Sbjct: 446 AYLHVLKLFFAEGRYSEAQDLLYGCPNHIRKHPDVIKLFGS 486 >gb|EMJ11699.1| hypothetical protein PRUPE_ppa002676mg [Prunus persica] Length = 646 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY HVFKSFF EGR SEAK+LLYKCP+HIRK + LFGS Sbjct: 598 AYVHVFKSFFKEGRDSEAKELLYKCPYHIRKLGEISKLFGS 638 >ref|XP_004971408.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Setaria italica] Length = 562 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -3 Query: 356 YQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 Y HV KSFF EGR+SEA+DLLYKCP HIRKHP V LF S Sbjct: 516 YLHVLKSFFAEGRYSEAQDLLYKCPIHIRKHPHVTKLFES 555 >ref|XP_004515865.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 641 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 356 YQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGSA 234 Y +FKS F+EGR SEAKDLLYKCP HIRKH + LFGS+ Sbjct: 584 YLKIFKSLFEEGRLSEAKDLLYKCPPHIRKHSQISELFGSS 624 >ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Brachypodium distachyon] Length = 585 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 359 AYQHVFKSFFDEGRHSEAKDLLYKCPHHIRKHPAVCSLFGS 237 AY H+FKSFF EGR+SEA+DLLYKCP HIR+H + LF S Sbjct: 538 AYLHMFKSFFAEGRYSEAQDLLYKCPIHIRRHHDITKLFES 578