BLASTX nr result
ID: Rehmannia24_contig00020108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00020108 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443948.1| hypothetical protein CICLE_v10023937mg [Citr... 55 9e-06 >ref|XP_006443948.1| hypothetical protein CICLE_v10023937mg [Citrus clementina] gi|568852874|ref|XP_006480095.1| PREDICTED: beta-carotene isomerase D27, chloroplastic-like [Citrus sinensis] gi|557546210|gb|ESR57188.1| hypothetical protein CICLE_v10023937mg [Citrus clementina] Length = 259 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +3 Query: 198 KTVYNDNWLDTIVINYFSDTYQAVSGVKSNKSGYDGLVE 314 KTVYND W D I IN+ S + Q +G+K+NK GY+G+VE Sbjct: 63 KTVYNDGWFDQIAINHLSQSVQDATGIKNNKGGYEGMVE 101