BLASTX nr result
ID: Rehmannia24_contig00019395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00019395 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61839.1| hypothetical protein M569_12952 [Genlisea aurea] 68 1e-09 >gb|EPS61839.1| hypothetical protein M569_12952 [Genlisea aurea] Length = 473 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 323 MLNKIMKRGHRKPSKSEAIEPPIPTSSASNVTVNHASRL 439 M NKIMKRGHRKPSK E +EPP+PTSS++NVTVNHAS L Sbjct: 1 MFNKIMKRGHRKPSKLEPVEPPLPTSSSNNVTVNHASVL 39