BLASTX nr result
ID: Rehmannia24_contig00019348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00019348 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37711.1| Lysine-specific histone demethylase 1-2-like prot... 57 3e-06 ref|XP_006464693.1| PREDICTED: lysine-specific histone demethyla... 57 3e-06 ref|XP_006451960.1| hypothetical protein CICLE_v10007556mg [Citr... 57 3e-06 >gb|EXB37711.1| Lysine-specific histone demethylase 1-2-like protein [Morus notabilis] Length = 750 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +1 Query: 1 LYAVISREQALELQQQVNGESSNKFSFLFRNLGLKLMGPDSLGLLATALISKI 159 LY VIS EQA EL+ V G N+ S+L +NLGLKLMGP++LG+ + +LI+ I Sbjct: 682 LYTVISSEQARELEH-VTGGDENRLSYLVKNLGLKLMGPNALGITSNSLITSI 733 >ref|XP_006464693.1| PREDICTED: lysine-specific histone demethylase 1 homolog 2-like [Citrus sinensis] Length = 752 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +1 Query: 1 LYAVISREQALELQQQVNGESSNKFSFLFRNLGLKLMGPDSLGLLATALISKI 159 LY +ISREQA ELQQ + G S K S+L +NLGLKLMG +LG + ++LI+ I Sbjct: 680 LYTLISREQANELQQVIGGNES-KLSYLTKNLGLKLMGSSALGTVGSSLIANI 731 >ref|XP_006451960.1| hypothetical protein CICLE_v10007556mg [Citrus clementina] gi|557555186|gb|ESR65200.1| hypothetical protein CICLE_v10007556mg [Citrus clementina] Length = 752 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +1 Query: 1 LYAVISREQALELQQQVNGESSNKFSFLFRNLGLKLMGPDSLGLLATALISKI 159 LY +ISREQA ELQQ + G S K S+L +NLGLKLMG +LG + ++LI+ I Sbjct: 680 LYTLISREQANELQQVIGGNES-KLSYLTKNLGLKLMGSSALGTVGSSLIANI 731