BLASTX nr result
ID: Rehmannia24_contig00019089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00019089 (501 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517210.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 gb|EXC17561.1| hypothetical protein L484_012352 [Morus notabilis] 55 7e-06 ref|XP_002314711.1| hypothetical protein POPTR_0010s10090g [Popu... 55 1e-05 >ref|XP_002517210.1| conserved hypothetical protein [Ricinus communis] gi|223543845|gb|EEF45373.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/56 (55%), Positives = 36/56 (64%) Frame = +2 Query: 263 KPSKYFSLAKISSVFRKENKNPPXXXXXXXXXXXXXXXEVIRKYLKKVKPLYEKLS 430 K +KYFSL++ SSVF+K+ KN EVIRKYLKKVKPLYEKLS Sbjct: 155 KTNKYFSLSRFSSVFKKDPKNRENEGSNSVKRMSATAKEVIRKYLKKVKPLYEKLS 210 >gb|EXC17561.1| hypothetical protein L484_012352 [Morus notabilis] Length = 372 Score = 55.5 bits (132), Expect = 7e-06 Identities = 36/84 (42%), Positives = 43/84 (51%), Gaps = 8/84 (9%) Frame = +2 Query: 203 EFKRLAXXXXXXX---DVVDLRSKPSKYFSLAKISSVFRKENK-----NPPXXXXXXXXX 358 EFKRL + + +KYFSLA+ SSVF+KE K +P Sbjct: 137 EFKRLTTPQSQINLSGQIKNSNKSTNKYFSLARFSSVFKKEPKQHRGGDPDNVSGSSVKR 196 Query: 359 XXXXXXEVIRKYLKKVKPLYEKLS 430 EVIRKYLKKVKPLYEK+S Sbjct: 197 MSTTAKEVIRKYLKKVKPLYEKIS 220 >ref|XP_002314711.1| hypothetical protein POPTR_0010s10090g [Populus trichocarpa] gi|222863751|gb|EEF00882.1| hypothetical protein POPTR_0010s10090g [Populus trichocarpa] Length = 365 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/83 (44%), Positives = 45/83 (54%), Gaps = 7/83 (8%) Frame = +2 Query: 203 EFKRLAXXXXXXXDVVDLRSK-----PSKYFSLAKISSVFRKENKNPPXXXXXXXXXXXX 367 EF+RL + V L S+ +KYFSL++ SSVF+KENK+ Sbjct: 129 EFRRLNNNHPHFQNDVHLSSQINKKGSNKYFSLSRFSSVFKKENKSRENDNVPGSSVKRI 188 Query: 368 XXX--EVIRKYLKKVKPLYEKLS 430 EVIRKY KKVKPLYEKLS Sbjct: 189 SVTAKEVIRKYFKKVKPLYEKLS 211