BLASTX nr result
ID: Rehmannia24_contig00018959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00018959 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA30522.1| ORF 143 [Glycine max] 56 4e-06 >emb|CAA30522.1| ORF 143 [Glycine max] Length = 143 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 194 LVISFLHNFGNPRTQSYGYVKYRISNPSRK 105 ++ S LH FGNPRTQSYGYVKYRISNPSRK Sbjct: 55 MIRSTLHYFGNPRTQSYGYVKYRISNPSRK 84