BLASTX nr result
ID: Rehmannia24_contig00018825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00018825 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349693.1| PREDICTED: uncharacterized protein LOC102592... 79 5e-13 ref|XP_004247177.1| PREDICTED: uncharacterized protein LOC101259... 76 5e-12 gb|EPS72551.1| hypothetical protein M569_02211 [Genlisea aurea] 70 2e-10 gb|EOX94718.1| Uncharacterized protein TCM_004330 [Theobroma cacao] 70 2e-10 ref|XP_002524764.1| conserved hypothetical protein [Ricinus comm... 68 1e-09 ref|XP_002306781.1| hypothetical protein POPTR_0005s23300g [Popu... 67 3e-09 ref|XP_004158617.1| PREDICTED: uncharacterized LOC101223034 [Cuc... 65 1e-08 ref|XP_004140095.1| PREDICTED: uncharacterized protein LOC101223... 65 1e-08 ref|XP_004493688.1| PREDICTED: uncharacterized protein LOC101511... 64 2e-08 emb|CBI28709.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_003632306.1| PREDICTED: uncharacterized protein LOC100855... 64 3e-08 ref|XP_004495188.1| PREDICTED: uncharacterized protein LOC101500... 63 5e-08 gb|EXB22127.1| hypothetical protein L484_002441 [Morus notabilis] 60 2e-07 gb|ESW34442.1| hypothetical protein PHAVU_001G153100g [Phaseolus... 60 2e-07 ref|XP_002302107.1| hypothetical protein POPTR_0002s05180g [Popu... 60 2e-07 ref|XP_006444041.1| hypothetical protein CICLE_v10022155mg [Citr... 59 7e-07 ref|XP_004290612.1| PREDICTED: uncharacterized protein LOC101301... 59 7e-07 ref|XP_006604445.1| PREDICTED: uncharacterized protein LOC102663... 58 1e-06 gb|EMJ01707.1| hypothetical protein PRUPE_ppa011469mg [Prunus pe... 56 4e-06 >ref|XP_006349693.1| PREDICTED: uncharacterized protein LOC102592129 [Solanum tuberosum] Length = 270 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = -3 Query: 183 IEMETLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPL 4 +EMETLVVVS H+NH YY R G +P +F SFGS S F INCR F+SG G+LPTPL Sbjct: 53 LEMETLVVVSQHKNH--YYDRTRGQAPIRFGSFGSPPSVGFKEINCRNFESGVGILPTPL 110 Query: 3 K 1 K Sbjct: 111 K 111 >ref|XP_004247177.1| PREDICTED: uncharacterized protein LOC101259575 isoform 1 [Solanum lycopersicum] gi|460403398|ref|XP_004247178.1| PREDICTED: uncharacterized protein LOC101259575 isoform 2 [Solanum lycopersicum] Length = 216 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVVS H+NH YY R G +P +F SFGS S F INCR F+S AG+LPTPLK Sbjct: 1 METLVVVSQHKNH--YYDRTRGQAPIRFGSFGSPPSVGFKEINCRNFESSAGILPTPLK 57 >gb|EPS72551.1| hypothetical protein M569_02211 [Genlisea aurea] Length = 193 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTP 7 METLV SHH++ HQYY R+ G+ PSK F S S F GI CR F+SG GLLPTP Sbjct: 1 METLVY-SHHKSSHQYYRRSRGHEPSKDAYFASPPSDGFRGITCRAFESGGGLLPTP 56 >gb|EOX94718.1| Uncharacterized protein TCM_004330 [Theobroma cacao] Length = 214 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV+ HRN QY SR + P++F GS S NF GINCRTF+SGAGLLPTP K Sbjct: 1 METLVVVAQHRN--QYCSRVKPHGPARF---GSSPSRNFRGINCRTFESGAGLLPTPFK 54 >ref|XP_002524764.1| conserved hypothetical protein [Ricinus communis] gi|223535948|gb|EEF37607.1| conserved hypothetical protein [Ricinus communis] Length = 204 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV+ HRNH QYYSR Y P++ + S TS +F INCRTF+SGAG+LPTP + Sbjct: 1 METLVVVNQHRNH-QYYSRLKSYKPARC-GYSSPTS-HFREINCRTFESGAGILPTPFR 56 >ref|XP_002306781.1| hypothetical protein POPTR_0005s23300g [Populus trichocarpa] gi|222856230|gb|EEE93777.1| hypothetical protein POPTR_0005s23300g [Populus trichocarpa] Length = 219 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/59 (61%), Positives = 42/59 (71%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV+ HRN QYYS + P+KF G+ S +F INCRTFQSGAGLLPTP + Sbjct: 1 METLVVVAEHRN--QYYSGVEPHGPAKF---GASPSKHFRDINCRTFQSGAGLLPTPFQ 54 >ref|XP_004158617.1| PREDICTED: uncharacterized LOC101223034 [Cucumis sativus] Length = 204 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 ME +VV+ HRN QYY R + P++F GS S +F G+NCR+FQSGAG+LPTPLK Sbjct: 1 MEAVVVIEQHRN--QYYDRVKPHGPARF---GSLRSRDFRGMNCRSFQSGAGILPTPLK 54 >ref|XP_004140095.1| PREDICTED: uncharacterized protein LOC101223034 [Cucumis sativus] Length = 204 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 ME +VV+ HRN QYY R + P++F GS S +F G+NCR+FQSGAG+LPTPLK Sbjct: 1 MEAVVVIEQHRN--QYYDRVKPHGPARF---GSLRSRDFRGMNCRSFQSGAGILPTPLK 54 >ref|XP_004493688.1| PREDICTED: uncharacterized protein LOC101511204 [Cicer arietinum] Length = 203 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV+ HRN QYYSR+ ++F GS + +F GINCRTFQ+G+G+LPTP K Sbjct: 1 METLVVVAQHRN--QYYSRSKTKGHAQF---GSVSPRHFRGINCRTFQTGSGILPTPFK 54 >emb|CBI28709.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METL+VV HRN QYY R+ + D F S S +F INCRTF+SGAG+LPTPLK Sbjct: 1 METLLVVPQHRN--QYYGRSKAHGS---DRFVSSPSSDFREINCRTFESGAGILPTPLK 54 >ref|XP_003632306.1| PREDICTED: uncharacterized protein LOC100855240 [Vitis vinifera] Length = 196 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METL+VV HRN QYY R+ + D F S S +F INCRTF+SGAG+LPTPLK Sbjct: 1 METLLVVPQHRN--QYYGRSKAHGS---DRFVSSPSSDFREINCRTFESGAGILPTPLK 54 >ref|XP_004495188.1| PREDICTED: uncharacterized protein LOC101500946 isoform X1 [Cicer arietinum] gi|502115377|ref|XP_004495189.1| PREDICTED: uncharacterized protein LOC101500946 isoform X2 [Cicer arietinum] gi|502115381|ref|XP_004495190.1| PREDICTED: uncharacterized protein LOC101501474 isoform X1 [Cicer arietinum] gi|502115387|ref|XP_004495191.1| PREDICTED: uncharacterized protein LOC101501474 isoform X2 [Cicer arietinum] Length = 196 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV H+N + S++ G+ FGS S F GINCRTFQS +G+LPTPLK Sbjct: 1 METLVVVDQHKNQYCSRSKSQGHG-----RFGSSPSKQFRGINCRTFQSDSGILPTPLK 54 >gb|EXB22127.1| hypothetical protein L484_002441 [Morus notabilis] Length = 206 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METL+VV+ HRN QY SR P +F S S +F GINCR+FQS AG+LP+PLK Sbjct: 1 METLMVVAEHRN--QYCSRVKSQGPGRF---WSSPSRDFQGINCRSFQSAAGILPSPLK 54 >gb|ESW34442.1| hypothetical protein PHAVU_001G153100g [Phaseolus vulgaris] Length = 194 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPL 4 METLVVV+HHRN Q Y + ++FDS S S +F INCRTFQ+G G+LPTPL Sbjct: 1 METLVVVAHHRN--QCYPPSKPQDHAEFDS--SSPSRDFRAINCRTFQTGCGILPTPL 54 >ref|XP_002302107.1| hypothetical protein POPTR_0002s05180g [Populus trichocarpa] gi|222843833|gb|EEE81380.1| hypothetical protein POPTR_0002s05180g [Populus trichocarpa] Length = 220 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLVVV+ HRN QYY++ P+KF G+ S +F INCRTFQS G+LPTP + Sbjct: 1 METLVVVAQHRN--QYYTKVRSNGPAKF---GTSPSKHFKDINCRTFQSRDGILPTPFQ 54 >ref|XP_006444041.1| hypothetical protein CICLE_v10022155mg [Citrus clementina] gi|568852059|ref|XP_006479698.1| PREDICTED: uncharacterized protein LOC102608532 [Citrus sinensis] gi|557546303|gb|ESR57281.1| hypothetical protein CICLE_v10022155mg [Citrus clementina] Length = 219 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METLV V+ H+N QYY R +F G+ S NF +NCR F+SGAG+LPTP+K Sbjct: 1 METLVAVAQHKN--QYYGRVKSNGSGRF---GASPSENFRDLNCRAFESGAGILPTPIK 54 >ref|XP_004290612.1| PREDICTED: uncharacterized protein LOC101301058 [Fragaria vesca subsp. vesca] Length = 213 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTP 7 METL+VV H +QYYSR + P + G S +F GINCRTFQSG+G+LPTP Sbjct: 1 METLLVVEHK---NQYYSRGKQHGPGRV---GPTPSKSFRGINCRTFQSGSGILPTP 51 >ref|XP_006604445.1| PREDICTED: uncharacterized protein LOC102663401 [Glycine max] Length = 190 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/62 (51%), Positives = 43/62 (69%) Frame = -3 Query: 186 LIEMETLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTP 7 +++METLVVV+ HRN Q Y+R ++F S S S +F INCR+FQ+G G+LPTP Sbjct: 1 MLQMETLVVVAQHRN--QCYTRPKPQGHAEFGS--SSHSRDFRAINCRSFQTGYGVLPTP 56 Query: 6 LK 1 LK Sbjct: 57 LK 58 >gb|EMJ01707.1| hypothetical protein PRUPE_ppa011469mg [Prunus persica] Length = 209 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = -3 Query: 177 METLVVVSHHRNHHQYYSRNHGYSPSKFDSFGSETSGNFPGINCRTFQSGAGLLPTPLK 1 METL+VV+ +N QYY+R + P ++ G S +F INCRTFQSG G+LPTP K Sbjct: 1 METLLVVAEPKN--QYYNRVKPHGPVRY---GPSPSKDFRAINCRTFQSGTGILPTPSK 54