BLASTX nr result
ID: Rehmannia24_contig00018243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00018243 (857 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291447.1| PREDICTED: adenine phosphoribosyltransferase... 57 9e-06 >ref|XP_004291447.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Fragaria vesca subsp. vesca] Length = 190 Score = 57.0 bits (136), Expect = 9e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 855 CACVIGLPQVKE*RRLNGRPLYILVEPNELIENCC 751 C CVIGLP+VK RLNG+PLYILVEP EL ENCC Sbjct: 157 CGCVIGLPEVKGQCRLNGKPLYILVEPREL-ENCC 190