BLASTX nr result
ID: Rehmannia24_contig00017596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00017596 (659 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230173.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 66 1e-08 ref|XP_006361868.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 65 1e-08 ref|XP_006344460.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 60 8e-07 dbj|BAC23030.1| ring H2 zinc finger [Solanum tuberosum] 59 2e-06 ref|XP_004236256.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 57 4e-06 >ref|XP_004230173.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum lycopersicum] Length = 432 Score = 65.9 bits (159), Expect = 1e-08 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = +1 Query: 4 FFTRGLSMRSPKVVAEAGE--SSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 171 FF+RG SM+SP+V AEAGE +SG+ RT VK+PSFKCLEPK DE L S + R PV Sbjct: 376 FFSRGSSMKSPRVGAEAGEGSTSGSMRTAVKLPSFKCLEPK-GDEASLMSTDSARPPV 432 >ref|XP_006361868.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum tuberosum] Length = 433 Score = 65.5 bits (158), Expect = 1e-08 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = +1 Query: 4 FFTRGLSMRSPKVVAEAGE--SSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 171 FF+RG SM+SP+V AEAGE +SG+ RT VK+PSFKCLEPK DE L S + R PV Sbjct: 377 FFSRGSSMKSPRVGAEAGEGSTSGSLRTAVKLPSFKCLEPK-GDEASLMSTDSARPPV 433 >ref|XP_006344460.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum tuberosum] Length = 398 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/59 (57%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 4 FFTRGLSMRSPKVVA---EAGESSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 171 FFTRG SM+SPKV A EA S + VKMPSFKCLEPK DE GL + + R PV Sbjct: 341 FFTRGSSMKSPKVRADNEEASTSRSNVKVAVKMPSFKCLEPK-GDEPGLLANDSARSPV 398 >dbj|BAC23030.1| ring H2 zinc finger [Solanum tuberosum] Length = 154 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/59 (55%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 4 FFTRGLSMRSPKVVA---EAGESSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 171 FFTRG SM+SPK+ A EA S + VKMPSFKCLEPK DE GL + + R PV Sbjct: 97 FFTRGSSMKSPKLRADNEEASTSRSNVKVAVKMPSFKCLEPK-GDEPGLLANDSARSPV 154 >ref|XP_004236256.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum lycopersicum] Length = 398 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 4 FFTRGLSMRSPKVVA---EAGESSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 171 FFTRG SM+SPKV A EA S + VK+PSF+CLEPK DE GL + + R PV Sbjct: 341 FFTRGSSMKSPKVRADNEEASTSRSNMKVAVKLPSFQCLEPK-GDEPGLMANDSARSPV 398