BLASTX nr result
ID: Rehmannia24_contig00017461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00017461 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343822.1| PREDICTED: protein ABIL2-like [Solanum tuber... 77 2e-12 ref|XP_004245491.1| PREDICTED: protein ABIL2-like [Solanum lycop... 77 2e-12 ref|XP_002303669.1| hypothetical protein POPTR_0003s14280g [Popu... 65 9e-09 ref|XP_004498509.1| PREDICTED: protein ABIL2-like isoform X2 [Ci... 63 3e-08 ref|XP_004498508.1| PREDICTED: protein ABIL2-like isoform X1 [Ci... 63 3e-08 ref|XP_003523358.1| PREDICTED: protein ABIL2-like isoform X1 [Gl... 63 3e-08 ref|XP_006405281.1| hypothetical protein EUTSA_v10027878mg [Eutr... 63 5e-08 gb|EOY23581.1| ABL interactor-like protein 2 isoform 1 [Theobrom... 63 5e-08 ref|NP_199018.1| ABL interactor-like protein 4 [Arabidopsis thal... 63 5e-08 ref|XP_002868565.1| hypothetical protein ARALYDRAFT_493780 [Arab... 63 5e-08 gb|AAM67279.1| unknown [Arabidopsis thaliana] 63 5e-08 ref|XP_003526721.1| PREDICTED: protein ABIL2-like isoform X1 [Gl... 62 6e-08 gb|ESW08506.1| hypothetical protein PHAVU_009G051500g [Phaseolus... 62 8e-08 ref|XP_006285711.1| hypothetical protein CARUB_v10007182mg [Caps... 61 1e-07 ref|XP_006595602.1| PREDICTED: uncharacterized protein LOC100808... 60 2e-07 ref|NP_001242020.1| uncharacterized protein LOC100808485 [Glycin... 60 2e-07 ref|XP_004498510.1| PREDICTED: protein ABIL2-like isoform X3 [Ci... 60 3e-07 ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis] g... 60 3e-07 ref|XP_002518857.1| Protein ABIL2, putative [Ricinus communis] g... 60 4e-07 ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula] gi|35549... 59 5e-07 >ref|XP_006343822.1| PREDICTED: protein ABIL2-like [Solanum tuberosum] Length = 335 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +3 Query: 201 NASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDKN 347 N SQ+ SNYDEIFM HSLQF++SLKDLKNLRKQLYSAAE FESSY +N Sbjct: 11 NGSQEGSNYDEIFMQ-HSLQFSDSLKDLKNLRKQLYSAAEYFESSYGEN 58 >ref|XP_004245491.1| PREDICTED: protein ABIL2-like [Solanum lycopersicum] Length = 333 Score = 77.0 bits (188), Expect = 2e-12 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +3 Query: 201 NASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDKN 347 N SQ+ SNYDEIFM HSLQF++SLKDLKNLRKQLYSAAE FESSY +N Sbjct: 11 NGSQEGSNYDEIFMQ-HSLQFSDSLKDLKNLRKQLYSAAEYFESSYGEN 58 >ref|XP_002303669.1| hypothetical protein POPTR_0003s14280g [Populus trichocarpa] gi|222841101|gb|EEE78648.1| hypothetical protein POPTR_0003s14280g [Populus trichocarpa] Length = 262 Score = 65.1 bits (157), Expect = 9e-09 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = +3 Query: 168 MWSDKEESYSVNASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 M + K S SVN Q+ SN+DE+FM SL F+++LKDLKNLRKQLYSAA+ FE +Y K Sbjct: 1 MDNSKTSSSSVNGPQEPSNHDELFM-KQSLLFSDTLKDLKNLRKQLYSAADYFELAYYK 58 >ref|XP_004498509.1| PREDICTED: protein ABIL2-like isoform X2 [Cicer arietinum] Length = 322 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +3 Query: 204 ASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 AS+ ASNYDE+FMH +L F +SLKDLKNLR QLYSAAE FE SY Sbjct: 9 ASRMASNYDEVFMHQ-TLLFDDSLKDLKNLRTQLYSAAEYFELSY 52 >ref|XP_004498508.1| PREDICTED: protein ABIL2-like isoform X1 [Cicer arietinum] Length = 359 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +3 Query: 204 ASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 AS+ ASNYDE+FMH +L F +SLKDLKNLR QLYSAAE FE SY Sbjct: 46 ASRMASNYDEVFMHQ-TLLFDDSLKDLKNLRTQLYSAAEYFELSY 89 >ref|XP_003523358.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max] gi|571451956|ref|XP_006578895.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max] Length = 325 Score = 63.2 bits (152), Expect = 3e-08 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +3 Query: 189 SYSVNASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDKN 347 S ++ SQ+ASNYDE+FM SL F +SLKDLKNLR QLYSAAE FE SY + Sbjct: 7 SATLPVSQEASNYDEVFMQQ-SLLFDDSLKDLKNLRAQLYSAAEYFELSYSND 58 >ref|XP_006405281.1| hypothetical protein EUTSA_v10027878mg [Eutrema salsugineum] gi|557106419|gb|ESQ46734.1| hypothetical protein EUTSA_v10027878mg [Eutrema salsugineum] Length = 282 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 213 KASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 ++SN+DE+FM +LQF+E+LKDLKNLRKQLYSAAE FE+SY K Sbjct: 13 QSSNHDELFM-KQTLQFSETLKDLKNLRKQLYSAAEYFETSYGK 55 >gb|EOY23581.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao] gi|508776326|gb|EOY23582.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao] Length = 325 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 S++ASNYDE+ MH SL FA+SLKDLKNLR QLYSAAE FE SY Sbjct: 10 SREASNYDEVSMHQ-SLLFADSLKDLKNLRTQLYSAAEYFELSY 52 >ref|NP_199018.1| ABL interactor-like protein 4 [Arabidopsis thaliana] gi|75170711|sp|Q9FHY1.1|ABIL4_ARATH RecName: Full=Protein ABIL4; AltName: Full=Abl interactor-like protein 4; Short=AtABIL4 gi|9757948|dbj|BAB08436.1| unnamed protein product [Arabidopsis thaliana] gi|51969198|dbj|BAD43291.1| unknown protein [Arabidopsis thaliana] gi|51969268|dbj|BAD43326.1| unknown protein [Arabidopsis thaliana] gi|51971595|dbj|BAD44462.1| unknown protein [Arabidopsis thaliana] gi|51972021|dbj|BAD44675.1| unknown protein [Arabidopsis thaliana] gi|57240098|gb|AAW49259.1| Abl interactor-like protein-4 [Arabidopsis thaliana] gi|87116640|gb|ABD19684.1| At5g42030 [Arabidopsis thaliana] gi|332007374|gb|AED94757.1| ABL interactor-like protein 4 [Arabidopsis thaliana] Length = 279 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 213 KASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 ++SN+DE+FM +LQF+E+LKDLKNLRKQLYSAAE FE+SY K Sbjct: 13 QSSNHDELFM-KQTLQFSETLKDLKNLRKQLYSAAEYFETSYGK 55 >ref|XP_002868565.1| hypothetical protein ARALYDRAFT_493780 [Arabidopsis lyrata subsp. lyrata] gi|297314401|gb|EFH44824.1| hypothetical protein ARALYDRAFT_493780 [Arabidopsis lyrata subsp. lyrata] Length = 279 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 213 KASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 ++SN+DE+FM +LQF+E+LKDLKNLRKQLYSAAE FE+SY K Sbjct: 13 QSSNHDELFM-KQTLQFSETLKDLKNLRKQLYSAAEYFETSYGK 55 >gb|AAM67279.1| unknown [Arabidopsis thaliana] Length = 279 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +3 Query: 213 KASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 ++SN+DE+FM +LQF+E+LKDLKNLRKQLYSAAE FE+SY K Sbjct: 13 QSSNHDELFM-KQTLQFSETLKDLKNLRKQLYSAAEYFETSYGK 55 >ref|XP_003526721.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max] gi|571460280|ref|XP_006581654.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max] gi|571460282|ref|XP_006581655.1| PREDICTED: protein ABIL2-like isoform X3 [Glycine max] Length = 326 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDKN 347 SQ+ASNYDE+FM SL F +SLKDLKNLR QLYSAAE FE SY + Sbjct: 13 SQEASNYDEVFMQQ-SLLFDDSLKDLKNLRAQLYSAAEYFELSYSND 58 >gb|ESW08506.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris] gi|561009600|gb|ESW08507.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris] Length = 327 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 SQ+ASNYDE+FM SL F +SLKDLKNLR QLYSAAE FE SY Sbjct: 13 SQEASNYDEVFMQQ-SLLFDDSLKDLKNLRAQLYSAAEYFELSY 55 >ref|XP_006285711.1| hypothetical protein CARUB_v10007182mg [Capsella rubella] gi|482554416|gb|EOA18609.1| hypothetical protein CARUB_v10007182mg [Capsella rubella] Length = 332 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 213 KASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 ++SN DE+FM +LQF+E+LKDLKNLRKQLYSAAE FE+SY K Sbjct: 67 QSSNNDELFM-KQTLQFSETLKDLKNLRKQLYSAAEYFETSYGK 109 >ref|XP_006595602.1| PREDICTED: uncharacterized protein LOC100808485 isoform X1 [Glycine max] Length = 324 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 S++ASNYDE+FM SL F +SLKDLKNLR QLYSAAE FE SY Sbjct: 10 SREASNYDEVFMQQ-SLLFDDSLKDLKNLRTQLYSAAEYFELSY 52 >ref|NP_001242020.1| uncharacterized protein LOC100808485 [Glycine max] gi|255638727|gb|ACU19668.1| unknown [Glycine max] Length = 324 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 S++ASNYDE+FM SL F +SLKDLKNLR QLYSAAE FE SY Sbjct: 10 SREASNYDEVFMQQ-SLLFDDSLKDLKNLRTQLYSAAEYFELSY 52 >ref|XP_004498510.1| PREDICTED: protein ABIL2-like isoform X3 [Cicer arietinum] Length = 311 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 216 ASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 ASNYDE+FMH +L F +SLKDLKNLR QLYSAAE FE SY Sbjct: 2 ASNYDEVFMHQ-TLLFDDSLKDLKNLRTQLYSAAEYFELSY 41 >ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis] gi|223544144|gb|EEF45668.1| Protein ABIL2, putative [Ricinus communis] Length = 312 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +3 Query: 204 ASQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 AS++ASNYDE+ M SL F++SLKDLKNLR QLYSAAE FE SY Sbjct: 6 ASREASNYDEVSMQQ-SLLFSDSLKDLKNLRTQLYSAAEYFELSY 49 >ref|XP_002518857.1| Protein ABIL2, putative [Ricinus communis] gi|223541844|gb|EEF43390.1| Protein ABIL2, putative [Ricinus communis] Length = 308 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSYDK 344 +++ASN+DE+FM S+ F+++LKDLK+LRKQLYSAAE FE SY K Sbjct: 15 TEEASNHDELFM-KQSMLFSDTLKDLKSLRKQLYSAAEYFEKSYSK 59 >ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula] gi|355491324|gb|AES72527.1| Protein ABIL2 [Medicago truncatula] Length = 326 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 207 SQKASNYDEIFMHNHSLQFAESLKDLKNLRKQLYSAAERFESSY 338 SQ+ASN+DE++M SL F +SLKDLKNLR QLYSAAE FE SY Sbjct: 13 SQEASNFDEVYMQQ-SLLFDDSLKDLKNLRTQLYSAAEYFELSY 55