BLASTX nr result
ID: Rehmannia24_contig00017460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00017460 (556 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66518.1| hypothetical protein M569_08260 [Genlisea aurea] 58 2e-06 >gb|EPS66518.1| hypothetical protein M569_08260 [Genlisea aurea] Length = 118 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +1 Query: 457 MAVDELIDLKFRLADGSDIGPSKYNASATVTSL 555 MA DEL++LKFRLADGSDIGPSKYN++A+V+SL Sbjct: 1 MATDELVELKFRLADGSDIGPSKYNSTASVSSL 33